SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000008711 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000008711
Domain Number 1 Region: 181-304
Classification Level Classification E-value
Superfamily Dystroglycan, domain 2 3.14e-58
Family Dystroglycan, domain 2 0.000000391
Further Details:      
 
Domain Number 2 Region: 61-160
Classification Level Classification E-value
Superfamily Cadherin-like 5.49e-19
Family Dystroglycan, N-terminal domain 0.00000351
Further Details:      
 
Domain Number 3 Region: 497-597
Classification Level Classification E-value
Superfamily Cadherin-like 1.88e-18
Family Dystroglycan, N-terminal domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000008711   Gene: ENSEEUG00000009582   Transcript: ENSEEUT00000009559
Sequence length 895
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_7170:9009:18256:1 gene:ENSEEUG00000009582 transcript:ENSEEUT00000009559 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRMSVDFSLLLPLWGRTFLLLLLVAVAQCHWPSEPSEAVRDWEHQLEASMHSVLSDLHET
APTVVGIPDGTAVVGRSFRVTIPTDLISSNGEVIKVSAAGKEALPSWLHWDPRSHTLEGL
PLDTDKGVHYISVSAARLGANGSHTPQASSVFSIEVSPEEHSEPQSMRAASADPGEVLPS
ACAADEPVTVLTVILDADLTKMTPKERLDLLHRMQSFSQVELHSMKLVPVVNNRLFDMSA
FMAGPGNAKKVVENGALLSWRLGCSLSQNNVPDIRGVEAPAREGAMSAQLGYPVVGWHIA
NKKPPLPKRIRRQIHATPTPVTAIGPPTTAIQEPPSRIVPTPTSPAIAPPTETMVPPVRD
PVPGKPTVTIRTRGAIIQTPTLGPIQPTRVAEAGTTVPGQIRPTVTIPGYVEPTAVITPP
TTTTKKPRVSTPKPATPSTDSSTTTTRRPTKKPRTPRPVPRVTTKAPATRLETASPPTRI
RTTTSGLPRGGEPNQRPELKNHIDRVDAWVGTYFEVKIPSDTFYDHEDTTTDKLKLTLKL
REQQLLGEKSWVQFNSNSQLMYGLPDSSHVGKHEYFMHATDKGGLSAVDAFEIHVHRRPQ
GDKAPARFKAKFVGDPAPVVSDIHRKIALVKKLAFAFGDRNCSTVTLQNITRGSIVVEWT
NNTLPMEPCPKEQIAGLSRRIAEDDGRPRAAFSNTLEPDFKAVSVSVVGSGSCRHLQFIP
VAPPRRVTSVAPPTEVPDRDPEKSSEDDVYLHTVIPAVVVAAILLIAGIIAMICYRKKRK
GKLTLEDQATFIKKGVPIIFADELDDSKPPPSSSMPLILQEEKAPLPPPEYPNQNVPETT
PLNQDTVGEYTPLRDEDPNAPPYQPPPPFTAPMEGKGSRPKNMTPYRSPPPYVPP
Download sequence
Identical sequences A0A1S3WGQ5
XP_007527314.1.11023 XP_016045563.1.11023 ENSEEUP00000008711 ENSEEUP00000008711

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]