SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000008902 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000008902
Domain Number 1 Region: 232-506
Classification Level Classification E-value
Superfamily Mitochondrial carrier 6.54e-79
Family Mitochondrial carrier 0.0000684
Further Details:      
 
Domain Number 2 Region: 44-224
Classification Level Classification E-value
Superfamily EF-hand 4.88e-35
Family Calmodulin-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000008902   Gene: ENSEEUG00000009766   Transcript: ENSEEUT00000009766
Sequence length 515
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_6975:40985:60327:1 gene:ENSEEUG00000009766 transcript:ENSEEUT00000009766 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSSVLCRCVASPPPDAAAAASSSTASSPASVGDPCGGAVCGGPDHQLRLWSLFQTLDVN
RDGGLCVNDLAVGLRRLGLHRTEGELRKIVQAGDKDLDGQLDFEEFVHYLQDHEKKLRLV
FKSLDKKNDGRIDAQEIMQSLRDLGVKISEQQAEKILKRIRTGHFWGPVTYMDKNGTMTI
DWNEWRDYHLLHPVENIPEIILYWKHSTIFDVGENLTVPDEFTVEERQTGMWWRHLVAGG
GAGAVSRTCTAPLDRLKVLMQVHASRSNNMCIVGGFTQMIREGGARSLWRGNGINVLKIA
PESAIKFMAYEQIKRLVGSDQETLRIHERLVAGSLAGAIAQSSIYPMEVLKTRMALRKTG
QYSGMLDCARKILAREGVTAFYKGYVPNMLGIIPYAGIDLAVYETLKNAWLQRYAINSAD
PGVFVLLACGTISSTCGQLASYPLALVRTRMQAQASIEGAPEVTMSSLFRQILRTEGAFG
LYRGLAPNFMKVIPAVSISYVVYENLKITLGVQSR
Download sequence
Identical sequences A0A1S3WJ73
XP_016046184.1.11023 ENSEEUP00000008902 ENSEEUP00000008902

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]