SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000009147 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000009147
Domain Number 1 Region: 299-355
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.39e-23
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 2 Region: 215-271
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.99e-22
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 3 Region: 340-392
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.49e-18
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 4 Region: 176-228
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.75e-18
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 5 Region: 27-69
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000000000122
Family KRAB domain (Kruppel-associated box) 0.0036
Further Details:      
 
Domain Number 6 Region: 261-293
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000448
Family Classic zinc finger, C2H2 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000009147   Gene: ENSEEUG00000010049   Transcript: ENSEEUT00000010031
Sequence length 426
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_3017:64:2714:1 gene:ENSEEUG00000010049 transcript:ENSEEUT00000010031 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPCPQVPLLACQGKTRDRQMAAALLSAWTQMPVTFEDVALYLSQEEWGRLDHAQQNCYRD
ILQRTTGLSLGLSVGRPLRASQVQAKTEASSLHPHTEDEAGACRAGALHWGKEEPSSSLA
TSEDAESLGGAQGVGWQNPDAGPLDPPEEDPRGTPKDAAKGSQGSQEAPEGEAGRKTFRC
EQCGKGFSWHSHLATHRRTHTGEKPYACTDCGKRFGRSSHLIQHQIIHTGEKPYTCPACW
KSFSHHSTLIQHQRIHTGEKPYVCERCAKRFTRRSDLVTHQGTHTGAKPHKCPVCAKCFT
QSSALVTHQRTHTGVKPYPCPECGKCFSQRSNLIAHNRTHTGEKPYHCLDCGKSFSHSSH
LTAHQRTHRGVRPYPCALCGKSFSRRSNLHRHEKIHTAGPKALAMLVLGAAAAAGALAAA
PPSAPT
Download sequence
Identical sequences ENSEEUP00000009147 ENSEEUP00000009147

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]