SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000009200 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000009200
Domain Number 1 Region: 530-711
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.54e-64
Family SPRY domain 0.0000029
Further Details:      
 
Domain Number 2 Region: 3-89
Classification Level Classification E-value
Superfamily DEATH domain 1.17e-20
Family Pyrin domain, PYD 0.0072
Further Details:      
 
Domain Number 3 Region: 302-367
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 1.68e-16
Family B-box zinc-binding domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000009200   Gene: ENSEEUG00000010063   Transcript: ENSEEUT00000010088
Sequence length 716
Comment pep:known_by_projection scaffold:HEDGEHOG:scaffold_296082:403:12581:-1 gene:ENSEEUG00000010063 transcript:ENSEEUT00000010088 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKTLSDHLLYSLEELVPYDFEKFKFKLQNISPEKEQPRIPSSQLQRAWPVRMAYLLRTY
YGEPGAVQLTLQVLRGMNQNQLAEELHRATSPENFIQEKDAGSSSGESMPRGLRMPEPAR
SRQLQSGKAGGQPETSGRASQKKPVNKHRDQKGPEVLCKPETKKLNVGTKRVLLPNKVQD
KSTGLRRNASSAGRLQGLFNSGVTRREHNVSSGKERPRSLEITISSSERELPNQGTLLTQ
ERLAQAGCPLYCAQERGPAGGACLPGSHSWPSMAPRDPKASNSRLPGCARCCEWQEGQPV
ASLSPRALPQCKRHLRQVQLLFCEDDEQPICLICKLSEEHRDHRVRPLEEAALDYKEQIQ
KQVKHLKELRCSVEEQRSHGHTTTEELLKQVAAQKQRVQRQLQELCQFLEQQEQLFVTWL
EDLGDAISQAGETYGTRVSGDIASLDELIWDLEARQCQSMWTLMQDIGVTLHRAKTMTIS
EPWTTSQDTEKKIQLLCQKSESVEKNMKRFSETLRSEIETFSVPDLMGAQAHAVQVTLDV
ETAHPNLAISEDRKSVRLGNKDNRLPDSPERFESCMVTLGCPSFFSGRHYWEVEVGDKTG
WILGVCKSNVNRKGSMTLSPEKGYWVLMMTRRNEYQVSTFPPTHLYIREPPRCVGIFLDY
KGGGISFYNVTTKSHIYTFTGFASSEPLRSMFSPGTHDGGKNVEPLTICPVGGQGP
Download sequence
Identical sequences ENSEEUP00000009200 ENSEEUP00000009200

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]