SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000009366 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000009366
Domain Number 1 Region: 127-327
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.05e-39
Family DBL homology domain (DH-domain) 0.00000747
Further Details:      
 
Domain Number 2 Region: 746-807
Classification Level Classification E-value
Superfamily SH3-domain 2.76e-21
Family SH3-domain 0.00078
Further Details:      
 
Domain Number 3 Region: 508-592
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000126
Family SH3-domain 0.001
Further Details:      
 
Domain Number 4 Region: 314-395
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000019
Family Pleckstrin-homology domain (PH domain) 0.0097
Further Details:      
 
Domain Number 5 Region: 596-699
Classification Level Classification E-value
Superfamily SH2 domain 0.0000000000031
Family SH2 domain 0.0026
Further Details:      
 
Domain Number 6 Region: 1-66
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.000000311
Family Calponin-homology domain, CH-domain 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000009366   Gene: ENSEEUG00000010212   Transcript: ENSEEUT00000010270
Sequence length 810
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_5763:4254:113275:-1 gene:ENSEEUG00000010212 transcript:ENSEEUT00000010270 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FLCLKNIRTFLRVCHDKFGLRNNTCYHFDLFDVRDFGKVISAVSRLSHHVVAQNKGIRPF
PSEETAENDDDVYRSLEELADEHDLGEDIYDCVPCEDEGDDVYEDIIKVEVQQPMXXXXX
XXXXXXXXXRSCCLLEIQETEAKYYRTLEDIEKNYMSPLRLVLSPADMASIFINLEDLMK
VHHSFLRAIDVSMMAGGGSLAKVFLDFKEXLLIYGEYCSHMEHVQNTLNQLLASREDFRQ
KVEECTLKVQDGKFKLQDLLVIPMQRVLKYHLLLKXXXXXXXXXXXXXXXXXXXXXXXDL
AMYINEVKRDKETLKKISEFQSSIENLQVKLEEFGRPKIDGELKVRSIVNHTKQDRYLFL
FDKVVIVCKRRGYSYELKEIIELLSHKMTDDPMNNKDVKKXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXRPSLLTDASGAGPGPKMVAVQNYHGNPAPPGKPV
LTFQTGDIIELLRGDPESQWWEGRLVQTRKSGYFPSSSVKPCPVDGRPPISRLPSRETDY
TVYPWFAGNMERQQTDNLLKSHASGTYLIRERPAEAERFAISIXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXELVEYYQCHSLKESFKQLDTTLKYPYKSRERVTSRASSRSPXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXFTPRVIGTAVARYNFAARDMRELSLREGDVVKIYSR
IGGDQGWWKGETNGRIGWFPSTYVEEEGVQ
Download sequence
Identical sequences ENSEEUP00000009366 ENSEEUP00000009366

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]