SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000009503 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000009503
Domain Number 1 Region: 5-236
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.07e-34
Family BAR domain 0.034
Further Details:      
 
Domain Number 2 Region: 389-508
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.14e-30
Family BCR-homology GTPase activation domain (BH-domain) 0.000039
Further Details:      
 
Domain Number 3 Region: 283-364
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000158
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000009503   Gene: ENSEEUG00000010373   Transcript: ENSEEUT00000010421
Sequence length 796
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_903:6755:155762:-1 gene:ENSEEUG00000010373 transcript:ENSEEUT00000010421 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGHPPLEFSDCYLDSPDFRERLKCYEQELERTNKFIKDVIKDGNALISSMRNYSSAVQKF
SQTLQSFQFDFIGDTLTDDEINIXXXXXXXXXXXXXXXXXXXXXVQNASDLLIKPLENFR
KEQIGFTKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXADLQVDKERHHFFESSLD
YVYQIQEVQESKKFNIVEPVLAFLHSLFISNNLTVELTQDFLPYKQQLQLSLQNXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXALGISWVKYYCQYQKETKILIM
IPMEQKSGAKQGPLELTLKNCVRRKTESIDKRFCFDIETNERSGTITLQALSEPNRRLWM
EAMDGKEPIYRSPITKQEEMELNEVGFKFVRKCINVIETKGIKTEGLYRTVGSNIQVQKL
LSAFFDPKCPGDIDFHNSDWDIKTITSSLKFYLRNLSEPVMTYRLHKELVSAAKSDNLDY
RLGAIHSLVYKLPEKNREMLELLIRHLVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXICSGPPEENVAPPVPPPRVTTRRHKPITISKRLLRERT
VFYTSYLEESEDVIQHQTPNGAIASNIDMSKPPQYSKLSVQRSGEANTERKSPTRPGSDG
KLESLPEVDVGKLSKLQDFGIKALPKATNGPGLVKAPSFHIKRLAPRPLVHYKEGDSDSF
SKVRPPGEKPTIIRPPVRPPDPPCRATTQKSQPKSDIGMGNTEDITSSVVASRTRFFEKA
SRKTGSCQGRLTGDES
Download sequence
Identical sequences ENSEEUP00000009503 ENSEEUP00000009503

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]