SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000009572 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000009572
Domain Number 1 Region: 754-978
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 7.07e-44
Family DBL homology domain (DH-domain) 0.0000000125
Further Details:      
 
Domain Number 2 Region: 380-526
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 7.85e-39
Family Regulator of G-protein signaling, RGS 0.000000262
Further Details:      
 
Domain Number 3 Region: 44-121
Classification Level Classification E-value
Superfamily PDZ domain-like 2.76e-20
Family PDZ domain 0.026
Further Details:      
 
Domain Number 4 Region: 981-1073
Classification Level Classification E-value
Superfamily PH domain-like 2.01e-17
Family Pleckstrin-homology domain (PH domain) 0.0000065
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000009572
Domain Number - Region: 149-160
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00183
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000009572   Gene: ENSEEUG00000010367   Transcript: ENSEEUT00000010500
Sequence length 1547
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_8111:32379:95316:-1 gene:ENSEEUG00000010367 transcript:ENSEEUT00000010500 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVRLPQSLDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLVQRCVIIQRDQHGFGFT
VSGDRIVLVQSVRPGGAAMKAGVKEGDRIIKVNGTMVTNSSHLEVVKLIKSGAYVALTLL
GSSSSPISISGLQQDPVPAGPPCLTPGIPPPPPPPPLPPPQHITGPKPLQDPEVQKHATQ
ILMSMLRQEEKELQHICEAYSRNPASMLEEQIEGARRRVSQLQLKIQQETGSSVDILPLC
GDLSQRAQEGRLSLDSQEGDSGLDSGTERFSSLSQSLMNRNSILSDPGLDXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXLFYLCVEVYQQTSLKDSRSLGKDIWNIFLEKNAPLRVKVP
EMLQAEIDLRLRNGEDVRGSLCDAQEAAMPEIQEQILDYRTKRTLGLGSLYGENDLLDLD
GDPGRERLIAEKQLAALGDILSKYEEDRSAPMAFALNTYMSHTGIRLREARPTSTTEKVQ
SAPDKDKWLPFFPKTKKSSNSKKEKDALEDKKRNPILKYIGKPKSSSQSTFHIPLSSVEV
KPGNVRNIIQHFENNQQYDAPEPGTQRLSTGSFPEDLLESGSSRAEIRLGRSESLKGREE
MKRSRKAENVPRSRSDVDMDAAAEAARLHQSASSSASSLSTRSLENPTPPFTPKMGRRSI
ESPSLGFCSDALLPHLLEDDLGQLSDLEPELEAQNWQHTVGKDVVAGLSQREIDRQEVIN
EHVTESHLRTLRVLDLIYQRMKKELMPREELARLFPNLPELIELHNSWCEALRRLREEGP
IIKDVGDLMLARFDGLAREELQQVAAQFCSHQSIALELIKTKQRKESRFQLFMQEAESHP
QCRRLQLRDLIISEMQRLTKYPLLLESIIKHTEXXXXXXXXXXXXXXXXXXXXXXVNEAV
KQTENQHRLEGYQKRLDTTSLERASNPLAAEFKSLDLTARKMIHEPLTWRISKDKTLDLQ
VLLLEDLLVLLQKQDEKLLLKCHSKAAGAADSKQTFSPVLKLNAVLIRSVATXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXWMELLEEAVRKATRHPAAPAPTPPAAPGPQEPTHQNP
SPSREDLEDADVFPDKPEPEELPAGTGPEQRPEGTHPSLLGNSQQGGCLEEGLPHPPTPL
DGVQRDSRTKGPILLPLPGPLFTEGLADAALEDVESLRHLILWSLLPSQPADTQPAGEPE
DDLTPTPSIISITSHPWDPGSPGQPPTGEDGDRTRLPGPELQDVGGCSLEHLPPRTRNSG
IWESPELDRKAEGETTSTEAMGSYKVVRKAEVAGSKAGPARPGSDQSGPKPPDVEGGPEA
AGNCFYVSMPAGPLDSSTDPSGVPTSPSMSDGPATWQVAPQHCQQQGGSGGPRNPSCSPP
SLVLRDTGLIFHTIEQLTLKLNRLKDMELAHRELLRSLGGESSGGTTPVGSFHAEPTRWT
DSSLSPPDKEALAPDSGDSHQLGPCPEDGIHTTLEDGSTSTASSPAL
Download sequence
Identical sequences ENSEEUP00000009572 ENSEEUP00000009572

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]