SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000009787 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000009787
Domain Number 1 Region: 77-121
Classification Level Classification E-value
Superfamily EF-hand 0.00000956
Family Calmodulin-like 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000009787   Gene: ENSEEUG00000010750   Transcript: ENSEEUT00000010747
Sequence length 157
Comment pep:known_by_projection scaffold:HEDGEHOG:scaffold_361555:5088:6393:-1 gene:ENSEEUG00000010750 transcript:ENSEEUT00000010747 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEFDLDGNGDIGEKLIGGGVGAGCRARKRDICLTGSIPSEVGKDSTSRIKVKVEIRKWGR
KEGDTSCDHPPPLPSDIMSLKRMLEKLGVPKTHLELKKLIKEVSSGSGETFSYSDFLNMM
LGKRSAILKMALMYEEKAKNTEKPVGPPAKKTISELP
Download sequence
Identical sequences ENSEEUP00000009787 ENSEEUP00000009787

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]