SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000010850 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000010850
Domain Number 1 Region: 22-103
Classification Level Classification E-value
Superfamily PH domain-like 1.29e-32
Family Ran-binding domain 0.00000985
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000010850   Gene: ENSEEUG00000011900   Transcript: ENSEEUT00000011888
Sequence length 201
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_3362:72431:82365:1 gene:ENSEEUG00000011900 transcript:ENSEEUT00000011888 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAATKDTHEDHDTSTENADESNHDPQFEPIVSLPEQEIKTLEEDEEELFKMRAKLFRFAS
ENDLPEWKERGTGDVKLLKHKEKGTIRLLMRRDKTLKICANHYXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXALKFKTKFEECRKEIEEREKKVGGGNDNAEKVV
EKLEALSVKEETKEKAEEEKQ
Download sequence
Identical sequences ENSEEUP00000010850 ENSEEUP00000010850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]