SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000010862 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000010862
Domain Number 1 Region: 243-297
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000194
Family SAM (sterile alpha motif) domain 0.0052
Further Details:      
 
Domain Number 2 Region: 833-863
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000349
Family Retrovirus zinc finger-like domains 0.0038
Further Details:      
 
Domain Number 3 Region: 44-101
Classification Level Classification E-value
Superfamily PX domain 0.0000719
Family PX domain 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000010862   Gene: ENSEEUG00000011890   Transcript: ENSEEUT00000011901
Sequence length 887
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_4458:6856:93210:-1 gene:ENSEEUG00000011890 transcript:ENSEEUT00000011901 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ISPRTETPISSVSNSLENALHTSAHSTDEPMPKRSVGKHSKVSVEKIDLKGLSHKKNERN
VECSFEVLWSDSSITPVTKSSSEVTEFISKLSQLYPEENLEKFILCAGPDSFYIERSHID
LEADLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPGNSSISKVGTMMGMSGRPVCG
VTGIPSSQSGAQHHMQHSANAAAIPHCSHTGAAGSALAYRTQIDTSPTILMPTSLQTPQT
QEQNGILDWLRKLRLHKYYPVFKQLTMEKFLSLTEEDLNKFESLTMGAKKKLKTQLELEK
EKSEKRCLNPSAPAPVTNSGVARVPPTSHVGPMQTVRGNPTAXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRRTAQ
VFPLQNEAGSPPGHHPLPPQLMPAASHLAPIRMLNSMHKSERGGADMKLLSSSVHSLLSL
EDRNKVSGPRSGMKVDKSFGNAMMDVLPTSSPHQPMQVLSGLNESSSMSPTVSFGPRAKV
VHAAALDRVMKPTQPPALVVETSSTASGTSSTVFHVARPPIKLLVSSSVPADSAISGQTS
CSNNVQISVPPAIINPRTALYTATTKAAFPAMGPLQGSFCANSSTASSSSHPSSSFANMA
SVPSCPAPSSSPALSSIPDSSFYSSSSGSSPGNIPASSQNHHHHHHHQQQPAAQQPTPAP
PPGCVVCTSCGCSGSCGSSGLTVSYANYFQHPFSGPSVFPFPFLPFSPVCSGGYVGTQQY
GSGTFPVVHSPYSSNVPPEPVLGSQSTFAVPPMQNFMAGAAGVYQAQGLVGSSNGSSHKK
SGNLSCYNCGATGHRAQDCKQPSMDFNRQGTFRLKYAPPAESLDSTD
Download sequence
Identical sequences ENSEEUP00000010862 ENSEEUP00000010862

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]