SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000010961 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000010961
Domain Number 1 Region: 445-501
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.46e-21
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 2 Region: 390-446
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.78e-19
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 3 Region: 486-538
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.1e-19
Family Classic zinc finger, C2H2 0.003
Further Details:      
 
Domain Number 4 Region: 351-403
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.81e-18
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 
Domain Number 5 Region: 35-71
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 0.0000000435
Family SCAN domain 0.00098
Further Details:      
 
Domain Number 6 Region: 225-259
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000405
Family KRAB domain (Kruppel-associated box) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000010961   Gene: ENSEEUG00000012001   Transcript: ENSEEUT00000012018
Sequence length 550
Comment pep:known_by_projection scaffold:HEDGEHOG:scaffold_346721:40118:52636:-1 gene:ENSEEUG00000012001 transcript:ENSEEUT00000012018 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKDQLGMAEAPQQQMGIPVVKLGKELLWGRGQEDPSPETFRLRFRQFRYQEAAGPQEAL
QLQDLCCRWLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXVPCHEQGEQQEAAALCRGPWEPAVHLGPVEVKPEWGMASGEGVQGLHQGTEE
QLSQDPGGGTQAFQEQALPILQAGPGLPPVSTREQDMAAGFLPAGPQALGPFKDMALAFP
EEEWRQVTPAQIDCFGEYVEPQDCRIASPGMGSKEKETKTQQADLKGALARLTSERFGEA
LLQSPELGRPCEQEQGISAGSSVGNVTGPLPPQPGLPALPEDLKPHSSFWKPFQCPECGK
GFSRSSNLVRHQRTHEEEKSYGCMECGKGFTLREYLMKHQRTHLGKRPYVCGECWKTFSQ
RHHLEVHQRSHTGEKPYKCGDCWKSFSRRQHLQVHRRTHTGEKPYTCECGKSFSRNANLA
VHRRAHTGEKPYGCQVCGKCFSKGERLVRHQRIHTGEKPYHCPACGRSFNQRSILNRHQK
TQHRQEAPVP
Download sequence
Identical sequences ENSEEUP00000010961 ENSEEUP00000010961

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]