SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000011587 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000011587
Domain Number 1 Region: 378-619
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.75e-72
Family Eukaryotic proteases 0.0000000109
Further Details:      
 
Domain Number 2 Region: 106-198
Classification Level Classification E-value
Superfamily Kringle-like 3.14e-31
Family Kringle modules 0.00000783
Further Details:      
 
Domain Number 3 Region: 213-300
Classification Level Classification E-value
Superfamily Kringle-like 4.83e-27
Family Kringle modules 0.0000204
Further Details:      
 
Domain Number 4 Region: 47-107
Classification Level Classification E-value
Superfamily GLA-domain 6.06e-19
Family GLA-domain 0.0000626
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000011587   Gene: ENSEEUG00000012688   Transcript: ENSEEUT00000012716
Sequence length 623
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_7580:6784:39813:1 gene:ENSEEUG00000012688 transcript:ENSEEUT00000012716 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHLRGLWLLCCLALAVLFSHVHSQHVFLDSQQALSLLQRVRARRANSGFLEELRKGNLE
RECVEEQCSYEEAFEALESSTATDLFWAKYTACESVRKPREKHSECLEGNCAEGLGMNYR
GQVNVTRSGIECQLWRSRYPHKPEINSSTHPGADLQENFCRNPDGSTTGPWCYTTVPTLR
REECSVPICGQVNTHVVLTPRSAGSSVSRSPSSEQCIPDRGRYYQGRLAVTMYGNPCLPW
ASTQAQSLSKDQDFNPDVPLVENFCRNPDGDQEGAWCYVDGGPGDFEYCDLDYCEEILGE
ETGLDDPEEAIEGRTVTEEFQPFFNEKTFGTGEADCGLRLLYEKIDLEDKTEQELLDSYX
XXXXXXXXXXXXXXXXXQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPWDKNFTVN
DLLVRIGKHSRTRYERNIEKISMLEKIIIHPRYNWKENLDRDIALLKLKKPITFSDYIHP
VCLPDKETAHRLLQAGHKGRVTGWGNLKETWKVSPSEVQPQVLQVVNLPLGGRRPPCKAS
TRIRITDKTFCTGMAPEEEKKGDSCEGDSGGPFVMKSPFNKRWYQMGIVSWGEGCDRDGK
YGFYTHVFRLKRWILKAIDQSGS
Download sequence
Identical sequences ENSEEUP00000011587 ENSEEUP00000011587

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]