SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000011609 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000011609
Domain Number 1 Region: 575-632
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.79e-23
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 2 Region: 537-589
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.24e-20
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 3 Region: 760-812
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.62e-18
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 4 Region: 688-741
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000146
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 5 Region: 632-687
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000821
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 6 Region: 218-255
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000000392
Family KRAB domain (Kruppel-associated box) 0.0045
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000011609
Domain Number - Region: 43-71
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 0.0916
Family SCAN domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000011609   Gene: ENSEEUG00000012727   Transcript: ENSEEUT00000012741
Sequence length 827
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_8307:1094:25189:1 gene:ENSEEUG00000012727 transcript:ENSEEUT00000012741 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MILTESGEVIDLDSPAETSQEQEDLLIVKVEEEDCAWMREYAPPFETFYPGFKHFQYHEA
SRPREALNQLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXTVACPEEIPQKMVPLEVVQEPLSPVLLSMETQTKQEPQKPHLL
AENALPTLQVASQKDSQELTASLLSAGSQKLVKIEDVADVAVSFILEEWGHVDQSQKPLH
KDDKEDNYASITSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSDKRSKTTKLKKKMTEFSEADLE
LSGRTQRNGSQNQDFGEDHEHQGKLDRKHPMKGTRGSSKRLSFSDITYAHKKSTGERPFK
CDECGKSFIQSAHLIQHQRIHTGEKPFRCDECGKSYNQRVHLTQHQRVHTGEKPYTCHLC
GKAFRVRSHLVQHQSVHSGERPYKCNECGKGFGRRSHLAGHLRLHSKDKSHQCHECGEIF
FQSVSLIEHQVLHMGQRNEKNSHCEEAYSWNLTVVEDKKIELQEQPYKCDICSKAFSYSS
DLIQHYRTHTVEKTSNCDLCRENVDQCSHIKHQKPYSNMKPHQCNECGRSFTLKSHLNQH
QRIHTGEKPFQCKECGMSFSWSCSLFKHLRSHERTEPITTLSVIFPF
Download sequence
Identical sequences ENSEEUP00000011609 ENSEEUP00000011609

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]