SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000012057 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000012057
Domain Number 1 Region: 142-456
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.11e-77
Family Protein kinases, catalytic subunit 0.000000000166
Further Details:      
 
Domain Number 2 Region: 2-111
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000123
Family Pleckstrin-homology domain (PH domain) 0.0000218
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000012057   Gene: ENSEEUG00000013220   Transcript: ENSEEUT00000013230
Sequence length 475
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_1779:1191:32015:-1 gene:ENSEEUG00000013220 transcript:ENSEEUT00000013230 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNEVSVIKEGWLHKRGEYIKTWRPRYFLLKSDGSFIGYKERPEAPDQSLPPLNNFSVARR
MKTDDPRPNXXXXXXXXXXXXXXXXXXXXXXXXXEEWMQAIQMVANSLKQRDPGKAYECG
SPSDSSAAEEMEVAVSKARAKVTMNDFDYLKLLGKGTFGKVILVREKATGRYYAMKILRK
EVIIAKXXXXXXXXXXXXXXXXXXXXXXALKYAFQTHDRLCFVMEYANGGELFFHLSRER
VFTEDRARFYGAEIVSALEYLHSRDVVYRDIKXXXXXXXXXXXXXXXDFGLCEGVSDGAT
MKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFELILMEE
IRFPRTLSPEAKSLLAGLLKKDPKQRLGGGPSDAKEVMEHTFFLSISWQDVVQKKLLPPF
KPQVTSEVDTRYFDDEFTAQSITITPPDRYDSLGSLEMDQRTHFPQFSYSASIRE
Download sequence
Identical sequences ENSEEUP00000012057 ENSEEUP00000012057

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]