SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000012461 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000012461
Domain Number 1 Region: 376-614,647-714
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 2.62e-53
Family Diacylglycerol kinase-like 0.017
Further Details:      
 
Domain Number 2 Region: 1-118
Classification Level Classification E-value
Superfamily EF-hand 1.98e-44
Family EF-hand modules in multidomain proteins 0.00000676
Further Details:      
 
Domain Number 3 Region: 186-253
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000000449
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.013
Further Details:      
 
Domain Number 4 Region: 99-183
Classification Level Classification E-value
Superfamily EF-hand 0.000000000000219
Family Calmodulin-like 0.029
Further Details:      
 
Domain Number 5 Region: 256-324
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000598
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000012461   Gene: ENSEEUG00000013636   Transcript: ENSEEUT00000013668
Sequence length 735
Comment pep:known_by_projection scaffold:HEDGEHOG:scaffold_349762:8566:35345:1 gene:ENSEEUG00000013636 transcript:ENSEEUT00000013668 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKERGLISPNDFAQLQKYMEYSTQKVSDVLKFFEEGSMADYIQGDAIGYEGFQQFLKIY
LEMDNVPSHLSMALFQSFQTGYCSYETNEVKNVVCLSDVSCYFSLLEGGKPEDKLEFTFK
LYDTDRNGILDSSEVDKIIIQMMRVAEYMDWDVSELKPILQKMMKEIDYDGSGSVSLAEW
LRAGATTVPLLVLLGLEMTLKDNGQHMWRPRRFPRPVYCNLCESSIGLGKQGLSCNICKY
VVHDQCAMKAQPCEVSTYAKSRKDIGVQSHVWVRGGCESGRCDRCQKKIRIYHSLVGLHC
VWCHLEIHDDCLPAVGQECDCGLLRDHILPPSSIYPSVLVSGKDRKSSKTSLKPVDDLSW
TTFEAMRIDPVPNTHPLLVFVNPKSGGKQGERVLWKFQYLLNPRQVFNLTKDGPEPGLRF
FREVPDCRVLVCGGDGTVGWILETIDKANLPVLPPVGVLPLGTGNDLARCLRWGGGYEGQ
NLGKILKDLEMSKVVYMDRWSLEVIPQETEEKSDPVPFHIINNYFSIGVDASIAHRFHIM
REKYPEKFNSRMKNKLWYFEFATSESIFSTCKRLEESLKVEICGKPLDLSNLSLEGIAVL
NIPSTHGGSNLWGDTKRPQGDIHGINQALGATAKLITDPDILKTCVPDLSDKRLEVVGLE
GAIEMGQIYTKLKNAGHRLAKCAEITFHTTKTLPMQIDGEPWMQTPCTIKITHKNQMPML
MGPPPRSSNFFGFLC
Download sequence
Identical sequences ENSEEUP00000012461 ENSEEUP00000012461

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]