SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000012521 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000012521
Domain Number 1 Region: 9-70
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.62e-25
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 2 Region: 251-308
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.49e-23
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 3 Region: 333-384
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.92e-17
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 4 Region: 212-261
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.59e-16
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 5 Region: 297-331
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000135
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 6 Region: 168-224
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000655
Family Classic zinc finger, C2H2 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000012521   Gene: ENSEEUG00000013740   Transcript: ENSEEUT00000013735
Sequence length 578
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_7481:703:14945:1 gene:ENSEEUG00000013740 transcript:ENSEEUT00000013735 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAGRSRARAQVSVTFEDVAVLFSREEWRKLGPSQRDLYQDVMLENYSNLVSLGLLFSKP
KVISLLQQGEDPWKVEKGGPGSSCLGWKSSDKTTKSTQRKDSSFQELRIRRSKRNVPCEF
KSEKLCIYEDTSEKRQERKASIHMVSATHKTVLTVERRHKNAEFDQNYSPKTNLVKQQVV
SKEKTPPKYEIEGNNFNQNSDLLHQLKINTVEKRYKCGLCEKTFINTSSLRKHEKNHSGE
KLFKCKECSKAFNQSSALIQHQITHTGEKPYVCKECGKAFTLSTSLYKHLRTHTVEKSYR
CKECGKSFSRRSGLFIHQKIHAGDNPYKYNPGRKSSLPGCQRLHSRKKSYLCNECGNSFK
SSSSLRYHQRIHTGEKPFKCSECGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTH
TRHKRFCNPFRQITFSVIHLRIPTGQKPYEWKGFGNFF
Download sequence
Identical sequences ENSEEUP00000012521 ENSEEUP00000012521

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]