SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000014105 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000014105
Domain Number 1 Region: 9-68
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.83e-23
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 2 Region: 174-223
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.43e-17
Family Classic zinc finger, C2H2 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000014105   Gene: ENSEEUG00000015461   Transcript: ENSEEUT00000015455
Sequence length 425
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_5970:4390:12205:1 gene:ENSEEUG00000015461 transcript:ENSEEUT00000015455 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATLFPSARCQDTVTFEDVAVIFTDEEWNLLDPIQRDLYKEVMLENYKSIVSLGLPVPQP
DRIFHLKREDETWMVDLHGSEKKKCPQKVSLDFATKSATQCASRTKTVETIRGRLGRRDP
LRPKYEVLALEDDLETEKETPVTETCNNSFSQVESLQPGSVLPKKILTRERNQECIECGK
SFTVHSSLIRHQRTHSGEKPYECLECGKVFSHRSSLSRHLMSHTXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXD
Download sequence
Identical sequences ENSEEUP00000014105 ENSEEUP00000014105

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]