SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000014314 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000014314
Domain Number 1 Region: 1143-1338
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.24e-57
Family BCR-homology GTPase activation domain (BH-domain) 0.0000239
Further Details:      
 
Domain Number 2 Region: 933-1056
Classification Level Classification E-value
Superfamily PH domain-like 4.02e-32
Family Pleckstrin-homology domain (PH domain) 0.00000051
Further Details:      
 
Domain Number 3 Region: 40-151
Classification Level Classification E-value
Superfamily PDZ domain-like 4.73e-17
Family PDZ domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000014314   Gene: ENSEEUG00000015659   Transcript: ENSEEUT00000015678
Sequence length 1950
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_1968:22543:189371:-1 gene:ENSEEUG00000015659 transcript:ENSEEUT00000015678 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATHRTGLTEGDGDKLKGYGSPVCEVSKNPDGKAQSDTVSPSEDETFSWAGPKTVLLKRT
SQGFGFTLRHFIVYPPESAIQFSFKDEENGSRGGKQRNRLKPMDTIFVKQVKEGGPAFEA
GLCTGDRIIKVNGESVIGKTYSQVIALIQNXXXXXXXXXXXXXXXXXXXLQFTKDVTALA
YSQDAYLKGNEAFSGNARNIPEPPPVCYPWLPAAPAAPVPPAETSPDPLASKQQPSAPVL
TQPARAYRMEIQVPPSPTDVAKSNTAVCVCNESIRTVIVPSEKVVDLLANRNSHTVPSHR
TEEVRYGLGELASFKTVSRASTSPPSSIPTAHLIQTPTAPRLSDPSGVVLKPGHYSSHSE
GHLGSRSQPADPPSVSANHYSPNSHQHIDWKNYKTYKEYIDNRRSHMGCRTIQERLDSLR
AASQNSGDYNQGTPSRSALQGRRRSTSHDRGPQSAQIRQRSVSQERLEDSVLMKYCPRSA
SQGALTAPPVGFSNHRTHSWDYIEGQGEPREQLSPDGQLPDANGERKQTYKWSGFTEQDD
RRGIPDRPRPQEVHKSFRGSNFTVAPSLAPADPRRVGGRGLSSGVPLKKVPPDLKTPPPS
SRNFPATCGMSLPRGFSSQDRSPLVKVRSHSLKAPSPPHPSRPPFSQNSLAPVRDQRLVN
HLHQNSLSSPQAWGRPEGTPDSPPETGKPPPPKPVTQASDAPGPSDSDPSVSQGNQDLHL
QEAEPQPLESSEAVILREKPPSGRQTPQPLRHQSYILAVNDQDSGSDTTCWLPNDARREV
HIKRMEERKASSSSPPGDSLASIPFIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSFKHLS
SLKGIKITDSPKSSEDSGSRKDSSSEVFSDAAKEGWLHFRPLITDKGKRVGGSIRPWKQM
YVVLRGHCLYLYKDKREQVTPSEEEQPISVNACLIDISYSETKRKNVFRLTTSDCECLFQ
AEDRDDMLAWIKTIQDSSNLNEEDTGVTNRDLISRRIKEYNSLMSKPEQLPKTPRQTLSI
RQTLLGAKSEPKTQSPHSPKEESERKLLSKDETSPPKDKGTWRKGIPSIMRKTFEKKPTA
TGTFGVRLDDCPPAHTNRYIPLIVDICCKLVEERGLEYTGIYRVPGNNAAISSMQEELNK
GMADIDIQDDKWRDLNVISSLLKSFFRKLPEPLFTNDKYADFIEANRKEDPLDRLKTLKR
LIHDLPEHHYETLKFLSAHLKTVAENSEKNKMEPRNLAIVFGPTLVRTSEDNMTHMVTHM
PDQYKIVETLIQHHDWFFTEEGAEEPLTAVQEENTVDSQPVPNIDHLLTNIGRTGVSPGD
VSDSATSDSTKSKGSWGSGKDQYSRELLVSSIFAAASRKRKKPKEKAQPSSSEDELDSVF
FKKENAELGPSELREDPRREGEVAGRKQWPPVFKENHTKKDSGAPKGDKAAPRKEDAPPE
AASLAPHAKHRSPALSCRLPSIPRESPKSLPGTPKASHLEEMGSDSGTLLSTSSQASLAR
CPPKKPGSSPETRHRDFLATVSTITSDYSTTSSATCPPSLDSSRLSPDVRSVAESRGDEA
DDERSELISEGRPVETDSESDFPVFPASERLARGRPPPPEAGKLGRCSSEGSEASCTEGS
LTPSLEARWPPFSSHKLIECDTLSRRKSARCRADGAGGEAKGDREAPALSRVFDVMKRGR
STGSLLPTSRGDTDKLEPTWKSKIADRLKLWPRAPAEDLLGVGGPKGSAEPTRRKHIKRR
HTLGGHRDTEMSALSFWRAQELSAVSRLRPKCPAQDLSITDWLTRERLRASSSDLSPAPD
PRPEKPGPLLETARTDAPFSLQLLLCNTGSPPGTSASTGQPPLSLPPPPQQPPDRMNGGS
FQNTTSQNADAQPHKLSASPGAKNLAHPCL
Download sequence
Identical sequences ENSEEUP00000014314 ENSEEUP00000014314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]