SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|52078696|ref|YP_077487.1| from Bacillus licheniformis DSM 13 = ATCC 14580

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|52078696|ref|YP_077487.1|
Domain Number 1 Region: 129-484
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 2.88e-89
Family N-acylglucosamine (NAG) epimerase 0.087
Further Details:      
 
Domain Number 2 Region: 1-74
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000285
Family Thioltransferase 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|52078696|ref|YP_077487.1|
Sequence length 625
Comment hypothetical protein BL00131 [Bacillus licheniformis DSM 13 = ATCC 14580]
Sequence
MAHESFEDEEVAKLLNEKFVSIKVDREERPDVDSIYMTICQMMTGQGGWPLNVFLTPDQK
PFYAGTYFPKTSRFNRPGFVEVVKQLSDTFAKNREHVEDIAEKAANNLRIKAKSDAGDSL
GEDILRRTYQQLINSFDAAYGGFGSAPKFPIPHMLTFLLRYHQYSGEENALYSVMKTLDS
MANGGIYDHVGYGFARYSTDDEWLVPHFEKMLYDNALLLIAYTEAYQITKNERYKQISEQ
IITFVRREMTDEKGAFYSALDADTEGVEGKYYVWSKEEVLETLGDELGELYCAVYNITQE
GNFEGHNIPNLIYTRLEDIKDEFALTDEELQNKLEEARTKLFEKRQERTYPHVDDKVLTS
WNALMIAGLAKAAKVYNAPEYLEMARAAAEFIENKLIQDGRIMVRYRDGEVKNKGFIDDY
AFLLWAYIELYEASLDLTDLRKAKKLEADMKGLFWDEEHGGFYFTGSDAEALIVRDKEVY
DGALPSGNGVLAVQLSRLGRLTGDLSLHDQAAKMFAAFHGDVSAYPSGHTNFLQGLLSQF
MPQKEIVVLGKRNDPDRQKIVSALQQAFQPNYAVLAAESPDDFKGIADFAAEYKAVDNKT
TVYICENFACRQPTTNIDEALDQLV
Download sequence
Identical sequences A0A2A5Z7D5 Q65P20
gi|52078696|ref|YP_077487.1| WP_009330320.1.12567 WP_009330320.1.1290 WP_009330320.1.35764 WP_009330320.1.55910 WP_009330320.1.62618 WP_009330320.1.74244 WP_009330320.1.86759 WP_009330320.1.94809 279010.BL00131

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]