SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|52080423|ref|YP_079214.1| from Bacillus licheniformis DSM 13 = ATCC 14580

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|52080423|ref|YP_079214.1|
Domain Number 1 Region: 2-165
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.21e-40
Family Glutathione peroxidase-like 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|52080423|ref|YP_079214.1|
Sequence length 167
Comment thiol:disulfide interchange protein YneN [Bacillus licheniformis DSM 13 = ATCC 14580]
Sequence
MKKVLAAAFLLVLAGLAVWNFTGQKEAEIGIEKGDKAPDFTLPSLKNGNDVSLSDFKGKK
VLLNFWATWCRPCETEMPAMEELQNENQDIAVLAVNFTSSEKNEKTVKAFAERHGLHFPI
VLDRTGINAKYEIFSYPTTFIIDENGIIKDIVLGTMSKKNMEEKLGL
Download sequence
Identical sequences A0A2H5UTY0 Q62UI3
gi|52080423|ref|YP_079214.1| 279010.BL02941

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]