SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for psu|LmjF06.0950 from Leishmania major strain Friedlin

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  psu|LmjF06.0950
Domain Number 1 Region: 305-669
Classification Level Classification E-value
Superfamily SIS domain 1.02e-93
Family double-SIS domain 0.00000102
Further Details:      
 
Domain Number 2 Region: 2-280
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 3.86e-46
Family Class II glutamine amidotransferases 0.00004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) psu|LmjF06.0950
Sequence length 670
Comment | organism=Leishmania_major | product=glucosamine-fructose-6-phosphate aminotransferase, putative | location=Lmjchr6:404102-406114(+) | length=670
Sequence
MCGILGYANSNVPRTVEQILSILLCCIQKVEYRGYDSAGLAIDANIGSDKEDGTAASAPT
LRPCVVRSVGNVNQLREKVFSEAVAATLPPMDATTSHHVGIVHTRWATHGGVCDRNCHPQ
QSNNGEFTIVHNGIVTNYSALKELLKGEGYVFYSDTDTEVISVLSEYLYTRKGIHNFADL
LLEVSRMVEGSYALLVKSVYFPGQVAASRQGSPLMLGIRRTDDRGCVMQLQTHDLTDLSG
PLEVFFSSDSNAFAEYTRDVVYLEDSDIVHYCDGALRFYNAAERQRSIIKREVQHLQTKL
ENLSKGNYAHFMLKEIYEQAESVISTMHGRVDFSSGTVQLSGFTQQNIRVILTSRRILFI
ACGSSLNSCIAVRPLFEELVPLPISVENASDFIDRRPQVQRNDTCFFISQSGETADTLMA
LKLCSEAGAMCVGITNVVESSISRLTHCGIHLKAGVEVGVASTKAYTSQVIVMTLVALLL
SSDSVRLQERRNEILRGLSEVSARIAEVLRITHDPVKALAARLKESRSIIVLGRGYDLAT
AMEAALKVKELSYVHTEGIHSGELKHGPLALIDETVPVLAMCTSDKHFDLSKAAVQQVNA
RNGAVVVFATEVDAELKAAASEIVLVPKTVDCLQCVVNVIPFQLLAYYMALLHGNNVDCP
RNLAKSVTVQ
Download sequence
Identical sequences Q4QIY2
psu|LmjF06.0950 gi|157864312|ref|XP_001680866.1| gi|68124158|emb|CAJ02141.1| XP_001680866.1.98313

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]