SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for psu|LmjF12.0530 from Leishmania major strain Friedlin

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  psu|LmjF12.0530
Domain Number 1 Region: 50-601
Classification Level Classification E-value
Superfamily SIS domain 3.95e-214
Family Phosphoglucose isomerase, PGI 0.00000000000000357
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) psu|LmjF12.0530
Sequence length 605
Comment | organism=Leishmania_major | product=glucose-6-phosphate isomerase | location=Lmjchr12:293731-295548(+) | length=605
Sequence
MSDYLSKLKEYVLESTEVNGCAPSMATSTFNAPYEVARRTKMLGATDSSLLSLPAWKRLQ
SLYEKHGNESILSHFESDHQRFGRYSIEVGLHSEDNFLFLDYSKSHINDEIKDALVALAE
ERGVRAFAKAMFDGQRVNSTEDRAVLHVALRNRSNRPIIVDGKDVMTDVNNVLAQMKNFT
EKVRSGEWKGQTGKSISNIVNIGIGGSDLGPVMVTEALKPFSKRDMHCFFVSNVDGTHMA
EVLKQVNLEETIFIIASKTFTTQETLTNAMSARNALMDYLKAHNISTDGAVAKHFVALST
NTEKVREFGIDTVNMFVFWDWVGGRYSVWSAIGLSVMLSIGYDNFVEFLTGAHVMDNHFA
STPTEQNLPMMLALVGIWYNNFFGAETEAVLPYDQYLWRLPAYLQQLDMESNGKGVTKKS
AAVAVQTGSIIFGEAGTNGQHAFYQLIHQGTKIIPCDFIGCVQTQNRVGDHHRILMSNFF
AQTEALMVGKSAEEVRQELVKSGMSGEAMERMIPHKTFTGNRPSNSILVNALTPRALGAI
IAMYEHKVLVQGAIWGINSYDQWGVELGKVLAKSILPQLKSGNIVSDHDGSTNGLINMFN
TRAHL
Download sequence
Identical sequences Q4QGN9
XP_001681659.1.98313 gi|157865905|ref|XP_001681659.1| gi|68124957|emb|CAJ02649.1| psu|LmjF12.0530

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]