SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for psu|LmjF23.1540 from Leishmania major strain Friedlin

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  psu|LmjF23.1540
Domain Number 1 Region: 10-99
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000159
Family Fibronectin type III 0.0063
Further Details:      
 
Weak hits

Sequence:  psu|LmjF23.1540
Domain Number - Region: 206-249
Classification Level Classification E-value
Superfamily SIS domain 0.0534
Family mono-SIS domain 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) psu|LmjF23.1540
Sequence length 965
Comment | organism=Leishmania_major | product=hypothetical protein, conserved | location=Lmjchr23:752665-755562(+) | length=965
Sequence
MPPASLTFEPPSVVAVFATHAVLCWEQPRTPHTTSFAEHMAWEYQIEYNCSCRVRQQPYC
ATGSNTFVLLATPHEGETYYVRVVAKASFAGSTSGLVSAKAAFTASCNVAMPWRCSARPP
VCVFDALYLSANVEAEDIAALSAARSSTIDNAAVLDGKSVCYTLEGDIAVRTYRMLYSGT
AALPVGPARTVYYMVATTRLHTGKRTRAMELLSIMQREGASIVFCGIGDGGRLALCAALT
FLSFLTTACPALCASVLCITYGTPRLLLKEGPRLLAHTLPLSGQLLHFTQLPLIEHTPFV
SDTVALSQRGSGVAVDTPPLGYANGFYRNMLLGAQCRVTDWTGLHFRLSSPDELSTEAEE
AEVFDVVGQLRALSELFFPSSLQWLSPSVTSVSCRTEGPLLHVSVEGANLHYCPRVTLTP
SYPRATPLFPRVVVITPLHLECTACLLPWVQQRAAGRGLRDAVPLNISAFLLVQTSLGTA
FAPAPATVALPEDLFELFCAAQQGSAPWSAEAAPGLVECALQLQPLYVLAGTDDVAFPSA
AGNALYNPLLESLCALASAAEVTLSPGYAGATAKPGSGLLDFISSVGARLSARAADAPTD
AVPALRVPGIEAAYLKNALKEWKGTGFTGVEVWRSRCASWRQRIFGVLSLLSEISYRNTL
VRMLRVLDGDAEVDEDVPFACIEAYLYAHTKYHINAAQCSPVYMDQLLYTELSLSSFYGA
VAHIFKSEASSASGSPLSYLRESMLLWALCHCFELRREVARTTFCCSVGCAGCGVSTLSS
CISSLLHHKEARRHGRRGTCFRTVQCRVASSDLSAVYLAAQTGVRCCVFLAAEASDLTRT
EYTSMSVHIQERLAYSGQHVFRVITKADEHLQSISDLRKELENETSWAALMSRVGAQLLG
GCGTEEQRLVVALAPSTSRLVELLACTPAEVEQYAQRLRSYSEALLLDCLRLSVLRGDAD
CPRTA
Download sequence
Identical sequences Q4QAY4
psu|LmjF23.1540 gi|157869926|ref|XP_001683514.1| gi|68126579|emb|CAJ05118.1| XP_001683514.1.98313

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]