SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for psu|LmjF33.1580 from Leishmania major strain Friedlin

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  psu|LmjF33.1580
Domain Number - Region: 174-259
Classification Level Classification E-value
Superfamily SIS domain 0.00114
Family mono-SIS domain 0.039
Further Details:      
 
Domain Number - Region: 86-136
Classification Level Classification E-value
Superfamily PK C-terminal domain-like 0.033
Family Pyruvate kinase, C-terminal domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) psu|LmjF33.1580
Sequence length 327
Comment | organism=Leishmania_major | product=hypothetical protein, conserved | location=Lmjchr33:752701-753684(+) | length=327
Sequence
MIAIAATPTLSNGAGMAVQRLRILLPGERRGEVRLLTFKKSVLTAASFEEATHDGYTHRL
GSPYRQGYGDTHRMVDKVLHQAPLRAVAITEDGKSGVTMSEQGMRIRVLDFVGDDKMTNR
LTLDRGHLPAVVDTVSLAIVAVPQAHPLMRNAAAPTAYTHERCGSNDNNAPAHVSEALSR
QYQHLTEAVHDIVVCLTSSGTTHIFGCGLQQVLFYHSDKTLLPRVGYPYAFSVCLPPLLA
KEGVVSVFVARSDVTTSAVHYLPRHEHYVTKGGKRDSSNDATDHLPGEFFAFELRYHSST
AAAAAAAGGAGSTSKYTMLFCFVLSAP
Download sequence
Identical sequences Q4Q429
XP_001685919.1.98313 gi|157875023|ref|XP_001685919.1| gi|68128992|emb|CAJ06406.1| psu|LmjF33.1580

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]