SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for psu|LmjF07.0120 from Leishmania major strain Friedlin

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  psu|LmjF07.0120
Domain Number 1 Region: 741-776,804-966
Classification Level Classification E-value
Superfamily Sec7 domain 3.66e-40
Family Sec7 domain 0.00013
Further Details:      
 
Domain Number 2 Region: 516-643,788-835,915-967,1342-1477,1527-1573,1628-1640,1669-1709
Classification Level Classification E-value
Superfamily ARM repeat 0.0000127
Family Clathrin adaptor core protein 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) psu|LmjF07.0120
Sequence length 2194
Comment | organism=Leishmania_major | product=hypothetical protein, conserved | location=Lmjchr7:43013-49597(+) | length=2194
Sequence
MAHHQPTNVEVENKVAFFVQLNALLTRVSSVVSSDALSSAQKAKLSDVRSATEAWLKDVG
IIGAPRPFIAASPPPPLRSSVTETPAAAAPLSETVAASEQQDEEQAEAALTQAPEAPAAE
QATATTSSAADGPARASASPATPGGSSTTTAALTSTHERADGRKLVGLVSYLRLLFDSDV
PERAKLQEFGKSLVRLLMVRCCSTIMASLQHVVHHTYTSTTTTAEEGDDAEAALSALFVQ
LAKEIDVATKALLGCVQLITSSAVLSEAASARFPLQLCVDVVKQTRRAQVYFQSRVEREE
IYLLRTFVTSSDTAAKSAEGLLEDVDAVHDALESVSPERVAAHVLRRVEALRRRWGPSLV
HSVRKIGDVIEPSVKFLAAVAAVRAEGAPAPLVALKKDAAHDLFSLCEPVTAAAAGGQAS
LAKSLSTCDSPSVVAAPVSASSATPLARRAAAGEVLIRLGSSFSADYLAAVAACCGDNNE
GELLATRLLTDMLKCVAAHDLPLLRCVLLDGRWYRALYDGILNCVSSSQPAVLAAGLDAL
GLLTTACPVVIGREVGLLYSNVVLRLLESSNTPRYVKRTIVLHFVTTFMGSGSTLPADGG
GAAVPLILHLYRLYDLNVHAHQLNLMQQLTSALSRIVRAAPKEEFMQDAVVQEQLRIQQE
AAPSAVMTAPAAQLDGAQHRTGVGNGTTSSEPSSSTAATLNPASLSLPAIALHGLVRIVE
LLTTQTPPEEESGKDVLASLPAMTCRESKLKEQQEVDRFNAAPKKAIYKLFNVTAEDNAI
PASHADFSSQWEHTLLPPLTSTAAAKVEAVADFLNQVSSLNPEAVAEFLTTPEVFPLQVC
RAYLRRLPLAGCSVLEAISELLMCVQLPKEGQRIERLLEYFSAAYYEANRGHGIDSDIFP
FKSDTAVFIVVVATVMLNTNIHNPSAGMRLDAKTFRGQLCRCNNDESFAGSFVDDIFDRI
SRHPLESIKSIAADANASTDSTNRGSFDMFFVSQEEKRQLAFGLERQRMVRETQQLLKLR
TQQESLAPAPEGWWCAVAKDFFLSTWSSVCAVFGPAMYEGTTAAPSDVLLQCVRGLQSLL
CMAAAFDLPTECTVTLLTLLRMADATPVREHCRRAVLVVAATTYAVNFPVRCWVAVCQII
LEVRRTAAAATPPLVEDVFTRIEGITRLSVETEARRAADDSAPKTDRPTEAIHRAMEGIT
TTISGYAVGDVANLSSALAVLRRALEYTRIVHAKRRTDIVYFVNVRDFTAVVAPAYVELM
KKHSSSDDGLQALFECLVDLLCTMWVSYSTSRVMVAGPGPAAAGGKAETAETLTVDTAPA
DFAQSFRFLRSVYDVTLASASDGTATLLQMHTLQAIKEVLSRTVRMAEMTPAGQHLSLYT
MMASWQEMLYPLAVALCDRNSTAVEAGSLALLVLRKLVALCGGTGTASSDRLPGPVRAAL
LWLLAQLAYMGGMCGDADSAQVCVALLSSICTTTVAMSVTAASSSSPWCGAAGPASPVTA
VADPSTVARLMEQRNALTQQVVTSIEENPHYVVQCTLARLCLLLRCEREQTRAEVMHQLR
TLSLQMRPAQLCPMALDLAEVVLEGTIGHDACHRDAPHTQSSLIPFLFFQMPVPASMRRC
SRTSFRATVPAALGFLANELLTGLSGDDLATAAESVMRRCLLPILLSRNSPHQSRFIAVR
SLSQCISVCLPQNSTAPSPQLAQCVLDCLAMALYGVRVPLTSVVSPDTSFVGRRWLDAPA
TSSASGWAAYCAQATHTVELMDRAEPQWLVRGATPAAADAALSTLAATATEERDGAAATP
TSSHGGCATSDETHRARGGAAFVPDEALIEYVNLLAQMLAGVPKELQGVVANAAAAAAGS
ATPSAGAVAVPDMHTDDWKLPRASVMVLLQLCLQAGGTLFAVLWRVNHPHEVEQYALQSV
ESRREALAFTRKSGLLPHAAIRSVLQCYLKLAVLSTEYPSAELLEVTTDIIEGIRQVQAA
THAAAPMPSPPSLAVGGGAGAVTAGASNTSLAADSASLQRLPPQEQQHVRTCNSGMYQQL
SVVLGYLVRLLTGQSTSMASVAGWARRQEAFEAMALHPQFFSSLVSLLTPTAGTLIITVR
DYFAWYIAHAQLPHQASEIAGPVTVSGGAACSGEVTPTSAAESNEEGPSSSQLTALNGTQ
DGKGSAIGSYSVNGGGSVKRSDAKAATVSPVAGR
Download sequence
Identical sequences Q4QIT2
XP_001680916.1.98313 psu|LmjF07.0120 gi|157864412|ref|XP_001680916.1| gi|68124209|emb|CAJ06971.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]