SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jCVI|EHI_006750 from Entamoeba histolytica 1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jCVI|EHI_006750
Domain Number 1 Region: 563-870
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.69e-84
Family Protein kinases, catalytic subunit 0.00000198
Further Details:      
 
Domain Number 2 Region: 155-277
Classification Level Classification E-value
Superfamily PH domain-like 2.58e-16
Family Pleckstrin-homology domain (PH domain) 0.0096
Further Details:      
 
Domain Number 3 Region: 72-155
Classification Level Classification E-value
Superfamily PX domain 0.0000131
Family PX domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jCVI|EHI_006750
Sequence length 964
Comment | organism=Entamoeba_histolytica_HM-1:IMSS | product=protein kinase, putative | location=DS571197:21959-24853(+) | length=964
Sequence
MNETHVPVLTIHTNFRKNRQSCFSPSSITQSIDYNTEDVVVNTLVKEREISYTNIIISSV
KSEIMIDTINTIPIIVHTISFTCNSRIDTIQKTANDLYELDAFFKSKNPVNGFPLFPKRS
ISYPMRDTALCEYLQAVINISGVCDSEYFKQWISTSLPNSIISIRRPIISGELKKEGYIL
KRWVARYVLVKRNYLIYFVSDKEFSKLTLPTILDLKGANIKVSDMKEKTFHIKLSSGAVY
HFKTKTKELLGEWIVALQSSTVIIQRRRDRRQSVYSEETSHKPVTPILSLQELLTIQSTN
NEIINECMKIVQTHKEDTSLIHLCKRLESIDLLDAIELNQIISQIKEISLNHPEDVQLLK
LLRLLSSNEIKRIETRSKNHSHQSSRSQSRKQSISSLDMSLINSNESSTTVTPRSGVVCR
ICEATVLAEHLARHTYYCKTLNEICMKATTDAERLKGIVEEAKRISELKKTDCFKRLIEV
SDAAIRIMGESLQKQYDNLKVYNEVSADLVGSYQHDVCGYVFAFYVQKLIHHKTDILGKY
IENPNNPRQLLNVLGAGVRLDETWNNIGLKDFEIIKRINGGAYSSVYLVRKKVTNDIYAM
KIMKKADMIRKNVVDGVLAEKTILQRAQTPSVVKMYYAFQDTHNLFLVMEYCPGGDLRCL
LSNVGYLDETTAKIYSAEIVLALEYIHSLGCIHRDLKPDNVLIDKNGHLLLTDFGLSTVG
SKIEQTVEDSRLVCTPDYVAPESIVSFQYSRCSDYFSLGSMIFEFICGIPPFHEETPDAI
FQNIRTGKYSWPSSINPSNELKSIVSGLLTVEVKKRLGYKSVQEIKSHPWFEGINWNTLL
NESREDIFVPELDNETDTGYFEVDNQTDNNTFSTDFNETKGSSVLSRMKGDHCEKFNKFN
GISFHHLVEENMSIANEVTTSENDRESNNNTDSDSQISVESFEEENNETDNPTDTKQDAK
SDHC
Download sequence
Identical sequences A0A175JMK5 C4M0E8 M3S6C9 N9UUH6
gi|56471517|gb|EAL49081.1| gi|67478098|ref|XP_654471.1| 294381.C4M0E8 jCVI|EHI_006750 XP_654471.1.49425

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]