SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jCVI|EHI_010750 from Entamoeba histolytica 1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jCVI|EHI_010750
Domain Number 1 Region: 442-716
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.44e-77
Family Protein kinases, catalytic subunit 0.00000402
Further Details:      
 
Domain Number 2 Region: 102-206
Classification Level Classification E-value
Superfamily PH domain-like 1.81e-23
Family Pleckstrin-homology domain (PH domain) 0.0071
Further Details:      
 
Domain Number 3 Region: 322-439
Classification Level Classification E-value
Superfamily PH domain-like 1.62e-18
Family Pleckstrin-homology domain (PH domain) 0.0074
Further Details:      
 
Weak hits

Sequence:  jCVI|EHI_010750
Domain Number - Region: 228-305
Classification Level Classification E-value
Superfamily PH domain-like 0.000536
Family Pleckstrin-homology domain (PH domain) 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jCVI|EHI_010750
Sequence length 726
Comment | organism=Entamoeba_histolytica_HM-1:IMSS | product=hypothetical protein | location=DS571182:83073-85253(+) | length=726
Sequence
MSEPPKPLSVKVVLMIDSHTLRFDKQVTKNTKIGDILAQIKGGLTNEQKKYEFSCFNDGI
RLVENNVIDFYGIDDGDEIEIKALNKPMAMARLSRVAPHEKDYHQIYLNSEKVGFLLKKK
VSKVSGWKRRWVVLCRGFLFYYNNPKDEIPIGKMQIKDTYIQFLGSDGEKQFVFQYENKP
DCYHFSCESEEEYISWRKVLIEHQTCLISTVAMKMIQESTDFSIVTINKTKKAWLMMNSG
TIFCFDSPAESESLFEFYIHESKVLTVAAEKEFTFVHLNNRKSIRFNTSSEYEKWKSMLT
DTVKMMGRDIYVDSFITDEYKDKKNIVKEGFLFKEKLKKMQTKKKRWCILTKNKLFYFNC
KPENDKNIPFGCFDLLLARVQLTHTNKGENILEIKTSEGEYQFTSNDSKELSIWADLIQR
ECTGAPTNVQHLQHVTFDLEWDTSGSDPNEIFCLKEVLGTGSFGTVYHAVHRQSNFEMAI
KILTVTKQQTDALKSEIDILKKCRSPNVVSYYGTIKIDENTLWILMDMCGVGSVKDLMKK
TMENLNEQQLRYVLNETLKGLVYLHSIKIIHHDIKAGNILLTNEGKVKLADFGVSQQYKE
NENKKAEDFIGSPLFMSPEVIKKSFYNNKTDIWSLGITVIEMAEGNPPNRHVTSFDQLLS
VIENKPPSFKNPKLWTTQLVDFVAQCLVIDYNQRPDAVTLLWHPFIVAQSPPPAQPLLNL
IKQVAN
Download sequence
Identical sequences A0A175JJY3 C4LYW2 M2S334 M3UKV2 M7WGP9 N9V021
gi|169802418|gb|EAL43940.2| gi|183231602|ref|XP_649328.2| jCVI|EHI_010750 294381.C4LYW2 XP_649328.2.49425

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]