SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jCVI|EHI_022600 from Entamoeba histolytica 1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jCVI|EHI_022600
Domain Number 1 Region: 1-196
Classification Level Classification E-value
Superfamily Flavoproteins 7.62e-35
Family Hypothetical protein YwqN 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jCVI|EHI_022600
Sequence length 201
Comment | organism=Entamoeba_histolytica_HM-1:IMSS | product=NADPH-dependent FMN reductase domain containing protein | location=DS571153:1373-1978(-) | length=201
Sequence
MVAKVLVLLGTLRANSNSAAYANAFIEGLKSKMEIDVKTINLTKKAVSGCSECFACVPHK
ELFCTEKDEFIEIANEFLNADIVLFAHPVFWLSIPGEVKNFIDRMICVFDFDNNTCKESF
KENFGKKYVVCMPNCRRTTKETAVNAEKPIECFCEMYGIPYSSVYLFANNMDVTQNVQQK
ETAKKAGIECGEKLMKQNNQF
Download sequence
Identical sequences A0A175JF26 C4LUJ7
jCVI|EHI_022600 gi|56464344|gb|EAL42874.1| gi|67463208|ref|XP_648261.1| 294381.C4LUJ7 XP_648261.1.49425

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]