SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jCVI|EHI_055350 from Entamoeba histolytica 1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jCVI|EHI_055350
Domain Number 1 Region: 140-204
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000125
Family SH3-domain 0.0021
Further Details:      
 
Domain Number 2 Region: 11-128
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000506
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jCVI|EHI_055350
Sequence length 208
Comment | organism=Entamoeba_histolytica_HM-1:IMSS | product=SH3 domain containing protein | location=DS571416:4510-5136(-) | length=208
Sequence
MTVTTKTPSTDVSFDVPLLRGYLTRRDPKGTHSWSKLWYQNSFENPLILECFADEKSTKV
VETINFKEVTDLKIVRTKAEDSTKKRYGFQFKYGKHTQKLLTDGEEEGEYWRDGFTSLSR
IAQGNAPTKSKLKKSSKESTNEYGLFPGEDFATTLVDFYSTDPGVLSFKKGEIVIIIGNI
ENGWIPVEFGGKRGWVPNEFIKPMGLKK
Download sequence
Identical sequences A0A175JXE2 B1N4I1 M2R1K2 M3SDQ2 M7WKD0 N9TKV5
gi|169800863|gb|EDS89126.1| gi|183234866|ref|XP_001914097.1| XP_001914097.1.49425 jCVI|EHI_055350 294381.B1N4I1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]