SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jCVI|EHI_064530 from Entamoeba histolytica 1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jCVI|EHI_064530
Domain Number 1 Region: 11-296
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 6.72e-40
Family ROO N-terminal domain-like 0.0000554
Further Details:      
 
Domain Number 2 Region: 263-410
Classification Level Classification E-value
Superfamily Flavoproteins 5.68e-36
Family Flavodoxin-related 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jCVI|EHI_064530
Sequence length 415
Comment | organism=Entamoeba_histolytica_HM-1:IMSS | product=type A flavoprotein, putative | location=DS571196:39344-40591(-) | length=415
Sequence
MTLKALKVCENLYWVGALDNDLRVFDIIMSTPYGTSYNSFLLTTSEGNILFETVKENFAQ
ECLSRVIDVIGESGKIDYIVCNHTEPDHSGSLVHILEKFPQATVIATFAALTNIKYIGHI
TKKTKTIDSTKNKQFKLGQYTLNFFIQPFLHWPDTMMTVIPELKVLLPCDVFGAHCADPR
VFNDEMTDRIKDLDDAYKHYFDCIFGPYTSFVLKGINILENDIGFPVDELKAICCSHGPV
LRTNIKENIERYKKWSQPKVLKDRVIIAYGSAYGYTEMMAEKIAEGVKSVGVEVIMHNIV
TSSVDAILNDFENSKGLLLGTPTLVGEALPPMYIILAHLNPIVHCSRYVQCFGTYGWSCE
GVRNLSVRIDQLMVRRPVRPLSFRFKPTEENLKECFEWGKTFATALLQNKEFVSE
Download sequence
Identical sequences A0A175JLL6 C4M0C2 M2RLK5 M3TTF0 M7X0C1 N9UT46
gi|56471042|gb|EAL48641.1| gi|67477004|ref|XP_654023.1| 294381.C4M0C2 jCVI|EHI_064530 XP_654023.1.49425

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]