SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jCVI|EHI_078170 from Entamoeba histolytica 1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jCVI|EHI_078170
Domain Number 1 Region: 1613-1886
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.81e-49
Family Protein kinases, catalytic subunit 0.00011
Further Details:      
 
Domain Number 2 Region: 466-799
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 5.65e-43
Family Myotubularin-like phosphatases 0.0069
Further Details:      
 
Domain Number 3 Region: 777-1057
Classification Level Classification E-value
Superfamily L domain-like 4.08e-35
Family Internalin LRR domain 0.003
Further Details:      
 
Weak hits

Sequence:  jCVI|EHI_078170
Domain Number - Region: 327-385
Classification Level Classification E-value
Superfamily PH domain-like 0.00311
Family TFIIH domain 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jCVI|EHI_078170
Sequence length 1894
Comment | organism=Entamoeba_histolytica_HM-1:IMSS | product=leucine-rich repeat domain-containing protein | location=DS571271:7932-13671(-) | length=1894
Sequence
MSAQVNKHIKGITKVDNRTSHKSKSTCTFNEQTRNATSCCLFVKTKENETEGEQCTIEGI
PLFVEHSFRFFELSSKIEKEVPPVPLQYLTYDTALLWASENMSKNFVDLVKMYKMDGNAI
SRLKMQDLRKYKFRIVECDTVLKKIKAYFHITNFGKRLLKNQGIDDSDLRQMYKYIDNHH
NGKLIPFNSMDKKQASTVAFLIIRNYLCSFDEIISETSFGEMIKFYHDHMRDDDDSFVRS
FDKVLQTCLTPLQYNVLIRTLRFMLVIMNSRGSVFVHFQDVFKKTMFSLISPISLDMDFT
FLLIFYSLKSRKPTNYIKMNLFQLNNKLLYGEYIIKQFDDILISDKTYTFHKQMNDVSTK
EWERGRIYITNFRVWWVPNDEECFQRNTRLLLLSYIPIRSIMEMKSFDSKEDITKEKKVC
VRMYDNLLRLFLFAFQSIQQLQDFRDELQMASVFEDNYPIDDVECISYEIPFKNYGEKKI
NRNGIHINSNEFKVFKEEENEYVIPYQLNNVDENKELPNIRGCIFLYKHSNGCTICRLSL
SKTVDKTKSFFLSTIDEVQKKYHAIYLSPQEKNDSMILKTSDEVNIIWNKIVDSAKKFTE
TTNFKEITTIFDEYIKYISIVFNNVFSLFVKVKLGESIMLQTRRDNETELPLYSSLIQFI
TDKYYWTYNGFVELIFVEFIQSNYFFFCNNGEICPIPHSFLIFIRIISLFVMTIPSAFEF
SQQLLNYLELICMSGRLRFNESRSQRSIVRLLVMKNKLKNQRYNSSTNVSLIDMYNENLF
SVQSLVLLFLKWMNVGKNCNFPLNPSIQNLDLQNKGIIALPVQENLKECHQLTQLNISQN
HLITIPSQITELSQLKDLNISTCSIYYIPYNCFSQLTNLTSLDISETSAINSELIKFPSF
SFLTKLEYLDISNHCKASGESIYLELPCSLRTFIAKQSLQTLPDLSKLKCLEKLDISDNR
QLKLNALAEVSSLRTFICRNRTTSTFPQQLFSIKLRYLDLSCDKIERLPQAFYNCITLES
LNLSNNQISTLSSQLSMLKNLKTLLIDNNPLTSKITLKPIPNSIPMSYPCYVHVFCTKGF
YSIFKKMIKMNKKSNFEFVSEISANSTKPQLILNFVDVEKTVIPYGMANDDLYIIHQEVK
DQAGLITHHILSNEKKYYFIGEKKMCCLLKKRKCKRSGTIGSDVEIIDAGPSMVDKLVSS
INSELNYKKEIRRIGMELYQTQYEEVTLTTKQMIQLVKFYNSNCDQTTLDELSNIGVIFD
LKKTEEGISECVKKGSESCPKGRYILRQVFDKKKNLVEKELSSFRPLREYFERLNKMTSD
DIINICRILQTHNALFMIYPNWINEMGITAESEKVIEKLKIPVEQPKRNKLNWKVGASGT
NKRCSLAETGSLSKRRSESLSPDEGGERLASKKDIFPVVLHPSIIKMKENAWPLHSKNEM
EIMREFVLGKPCYLMYMQLIGYLLLIGMELYDKIYNDATILKDERYSTTFLIKIQYCDGR
ISISIRYNTSSVSQVKISADIMQSIKKAINTIAVASNNTLEEYVGCTECILKDEKKIDVV
PVKEIKEARKEGKTEILFNKQHSVMIGTCALDILLNEMENSSIVPLFESKDMDIKEMKGF
GGSAKVNRVIVSHKEEMAFKMYTFNNYDKVSLKIGLGSTAHLVALKVEEMMKELEVLKLT
RGSSIRHTKYILQLHGICLEPLGILVDYMGEGTLQNYIGIKSNELPMTMVLRFAKNINNA
LDVLHSRNIIHRDVKSPNVLLKFNQQHQLIAVLSDFGLSGPYDENEHCMVENPLWLPPEV
LNTHHFLTASDIYAYGIILWEMITREKPFVGCKFMSEIANKIRAGERPQFKPNILIDNSL
KELIEMCWLEDPSKRPCCSQIKKVLQKVSKNLPH
Download sequence
Identical sequences A0A175JSR2 C4M543 M2S8A1 M3S1E6 N9TE18
XP_651994.2.49425 294381.C4M543 jCVI|EHI_078170 gi|169801624|gb|EAL46608.2| gi|183233328|ref|XP_651994.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]