SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jCVI|EHI_078200 from Entamoeba histolytica 1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jCVI|EHI_078200
Domain Number 1 Region: 580-895
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.59e-83
Family Protein kinases, catalytic subunit 0.00000188
Further Details:      
 
Domain Number 2 Region: 183-274
Classification Level Classification E-value
Superfamily PH domain-like 6.03e-17
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 
Weak hits

Sequence:  jCVI|EHI_078200
Domain Number - Region: 92-171
Classification Level Classification E-value
Superfamily PX domain 0.00085
Family PX domain 0.0084
Further Details:      
 
Domain Number - Region: 438-471
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0356
Family Growth factor receptor domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jCVI|EHI_078200
Sequence length 974
Comment | organism=Entamoeba_histolytica_HM-1:IMSS | product=protein kinase, putative | location=DS571271:17215-20139(+) | length=974
Sequence
MKIEKKLNLKSKICITMSLLNETTTPTKLSKKKKSIFNSDCITFTPIGSGSSTPRRESIL
SSLPNDELKEVSIENVISELYFDQLTLTTSIVHIININLPKTHIVLHKFMHELNELDKYV
TAVYGITAPYLPKKSFYPLHNEEITQYLQEVICLDKFFDSIYVKEFFRENHQISQCMSLH
HPQMSGVLMKEGYLLKRWKERFVVVKNSYLFYFVSEKSMVRLEQPRCIVSLSGAILSTNG
LVIKITTKERQSFNFSCTDETTLNQWLVALNAVICFKPSPQKQQRMTKKYTLLGVDELST
PIQSTKENKTVTPRRSTEFLISRVNCLKDEADKIIESYEHQPDKESLVMVLKQFKQIQSV
DLSSTSLIDYYNSKIVQFGDDPLLFRFLQIFKEIRELSGMRPNVPKLCTSPLGRYSLQPK
SSCSSSQTSPRTLTSQFTTQCRLCNNTYYVDELTKHSYYCKLCNEICLKQTTCKTRLLAI
AEEINKQKRYHKGSIEYSGLAEKALKCSQIEVINQNNIDYMNDAEQLLEQSINQKSDVCY
KTFALIVIKLIKLRRQMFINILKGDYGENGNMWEFLSVVSNELVIEDPQSKWQQVGLDDF
EVIKKFSEGAYSKLYLVKKKTTGDVYAMKVSKKSDMKRKNVIDGVLAEKKILQLSNTRSV
VKLYYAFQDSSNLFLVMEYCPGGDLRCILRNLNYLEESVVRIYTAEIILALEYIHSLGCI
HRDLKPDNVLIDKNGHLLLTDFGLSVVGLCNEQHGIKESRLLCTPDYVAPESLRDYYYCQ
ASDYFSLGCMVYEMLLGIPPFHCDSPNQIFELIKEGIYDWPEDVNISEECKDFVNGLLTV
DYNQRLGAKSIDEIKNHKWMKPISFDSLLSESREDIFVPELENELDTGYFDIDVDRNNTL
IKDEDWTGDNTFYSFDCVNTNQVIDQNIEIVERRSSAVNLCDDDDESSQETTSEQDDNNN
DMTRSMSMFNFHHK
Download sequence
Identical sequences A0A175JSX0 C4M546 M2RD38 M7W0H0 N9UMN1
gi|56468791|gb|EAL46604.1| gi|67472268|ref|XP_651990.1| XP_651990.1.49425 jCVI|EHI_078200 294381.C4M546

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]