SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jCVI|EHI_095940 from Entamoeba histolytica 1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jCVI|EHI_095940
Domain Number 1 Region: 5-282
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.53e-88
Family Protein kinases, catalytic subunit 0.000000644
Further Details:      
 
Domain Number 2 Region: 261-394
Classification Level Classification E-value
Superfamily PH domain-like 1.23e-21
Family Pleckstrin-homology domain (PH domain) 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jCVI|EHI_095940
Sequence length 395
Comment | organism=Entamoeba_histolytica_HM-1:IMSS | product=protein kinase, putative | location=DS571239:48074-49311(-) | length=395
Sequence
MAKRENNFIFGDTLGEGSFGAVILTTDKDDNKQYATKILDKQQIIKLKKHATVKRERDIM
SMCHSPYIVKLFYTFQNPTSLFYVLELCPNRDMKYYFLKYGSFSEKVTQFYISEITMALK
YLHSLNIIHRDLKPENILLDRNMHIKITDFGTACVQTPNDPPRKSSFVGTPEYVAPEIIN
GQIGFSKAVDMWSLGCMLFQFLTGEFPFRGKSDKLTFDAINACAPSYPHNMPVNAKDLCQ
KLMVLDMNNRIGVKSTDELLSHPFFTGIQFDSLLQQTPPPFEAGMAIPKIEDFIYPGLLK
EGEKVILYRTVYKRKGISNTKRDLIYTDLPRLFYCVSKTPNIKGEIPLTKDTSYFIKSGS
QFIIRVPGRDYQLEDCLGEPQVWINAFDATCHKWK
Download sequence
Identical sequences A0A175JQ10 C4M3E9 M7W889 N9UZ48
294381.C4M3E9 gi|56471973|gb|EAL49497.1| gi|67479003|ref|XP_654883.1| XP_654883.1.49425 jCVI|EHI_095940

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]