SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jCVI|EHI_096710 from Entamoeba histolytica 1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jCVI|EHI_096710
Domain Number 1 Region: 10-292
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 3.54e-41
Family ROO N-terminal domain-like 0.0000494
Further Details:      
 
Domain Number 2 Region: 260-405
Classification Level Classification E-value
Superfamily Flavoproteins 6.81e-39
Family Flavodoxin-related 0.00092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jCVI|EHI_096710
Sequence length 406
Comment | organism=Entamoeba_histolytica_HM-1:IMSS | product=type A flavoprotein, putative | location=DS571163:105317-106537(+) | length=406
Sequence
MKALEVVKDLYWVGVFDKELRVFDIIMTTPYGTSYNSFLLKSEKGNVLFETCKENFAGEC
LERIEDVIGKEGKLDYIVLNHTEPDHSGSLVHILEKYPEATVIGTMAALNNIKYIGHIKE
NTKTLNSGKIKTLDLGNYHLKFLIQPFLHWPDTMMTVIEEMKVLVSCDVFGGHYADERVF
NDQMMERIKDMDDAYKHYFDCIFGPFKNYVIKGLDMIETQMGFPSDELKAICCSHGPVLR
THIKENIERYRQWAQPIALKNKVVIAYGSAYGYTQKMAEQISEGIKSTGVEVKMFNIVES
SVGDVLKEFEDAKGLLLGTPTLVNDTIPPIMQIACSLNPTIHCNRFVQCFGSFGWSGEGV
KNLSARIVQLKVHQPVEPLSIKFQPNSNELQTCFEWGKKFAEALKA
Download sequence
Identical sequences A0A175JDE9 B1N2F9 M2RFZ2 N9V0I3
294381.B1N2F9 XP_001913357.1.49425 XP_656946.1.49425 jCVI|EHI_096710 jCVI|EHI_152650 gi|169803164|gb|EDS89854.1| gi|183229713|ref|XP_001913357.1| gi|56474182|gb|EAL51565.1| gi|67483345|ref|XP_656946.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]