SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jCVI|EHI_101250 from Entamoeba histolytica 1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jCVI|EHI_101250
Domain Number 1 Region: 330-583
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.08e-73
Family Protein kinases, catalytic subunit 0.0000152
Further Details:      
 
Weak hits

Sequence:  jCVI|EHI_101250
Domain Number - Region: 145-194
Classification Level Classification E-value
Superfamily PH domain-like 0.00167
Family Pleckstrin-homology domain (PH domain) 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jCVI|EHI_101250
Sequence length 593
Comment | organism=Entamoeba_histolytica_HM-1:IMSS | product=serine/threonine-protein kinase, putative | location=DS571353:10049-11898(+) | length=593
Sequence
MAEAEKQRDLDETSKELIEKAIAVPQENRTKVDNLYFDVAVGFKEGQPLVYRLIWICFVE
RKLRLVRHRKIKEEYGLYTINYVSKYELNKIKLIIGENFVVIIQPQSLDDLNALFKVLRT
VTLNHNIPITKEEYLLDTLNLKKTFMVKKRGKTFWNKRVLDIYNGAIYLYENNIKDIPLT
ILPINDSVTIKKQSKGILEFVSLIRDLVIKFENDNERDEAAKLCKYCCQYSITPYNTPIK
DFFCGNLNDLIAVCRELCLKNYLYPEEGDQYFPVLCEILKSTTKKRYATMTEKRAMTTRT
DDASVSVTENKKHQSTQIDDGEELATIAEKEDPKQYFTNFVSIGKGGFGEVFVVTRKDDG
KQVALKILKHGANERFSKIGIEVARLYHWKHPNIVGFEGCWIFDNRVYIGMEYCSQGTLK
SLLKTKQRFNEPDTAFLVRETLRALQYIHEYGFIHRDIKTANIMLSATHAVKVIDFGLVV
RASNNPSNRAGSKAYMAPEVIKQEPYDCRVDIWSVGCVAQELIEGNPPYKEVGLVKGTFK
TATIGAMGLRNPTKVSKEFKDFIEKCFVFDFKKRPQCEELLKVCLLFCLYVDQ
Download sequence
Identical sequences C4M8B6 M2RX22 M3UN04 M7WVN1 N9UP78
gi|56474247|gb|EAL51627.1| gi|67483586|ref|XP_657013.1| XP_657013.1.49425 jCVI|EHI_101250 294381.C4M8B6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]