SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jCVI|EHI_113440 from Entamoeba histolytica 1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jCVI|EHI_113440
Domain Number 1 Region: 1-69
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.0000000000934
Family Protein kinases, catalytic subunit 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jCVI|EHI_113440
Sequence length 85
Comment | organism=Entamoeba_histolytica_HM-1:IMSS | product=serine/threonine- protein kinase3/4, putative | location=DS571429:6939-7196(-) | length=85
Sequence
MAEGNPPNRHVTSFDQLLSVIENKPPSFKNPKLWTTQLVDFVAQCLVIDYNQRPDAVTLL
WHPFIVAQSPPPAQPLLNLIKQVAN
Download sequence
Identical sequences A0A175JYQ6 B1N4L0
gi|169800807|gb|EDS89095.1| gi|183234976|ref|XP_001914126.1| XP_001914126.1.49425 jCVI|EHI_113440

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]