SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jCVI|EHI_126000 from Entamoeba histolytica 1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jCVI|EHI_126000
Domain Number 1 Region: 26-225
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.4e-35
Family DBL homology domain (DH-domain) 0.00062
Further Details:      
 
Domain Number 2 Region: 225-343
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000262
Family Pleckstrin-homology domain (PH domain) 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jCVI|EHI_126000
Sequence length 353
Comment | organism=Entamoeba_histolytica_HM-1:IMSS | product=Rho guanine nucleotide exchange factor, putative | location=DS571160:81990-83112(+) | length=353
Sequence
MEVQRLEIIQSYCRGFLTRRVYNKSSVFRRFDVINEFSTTEVSFVDSMRKLDVFFNEPLI
ERAKNPETTILPLLMIKSILPRIESVFLNGCLIANTFEDIRVRWKYDSCFGDALVKCVEL
MTPLAEYTLLFETQRRSLVSAFKVKGFKEFIKRQSIIKDLNGLSFNDLIIMPVQRLMRYP
ILLKELIKNTSSFHPEYQRLEEIQLKFEKLISNVNTQSKMHDCLLDVSSCICCSENLVQS
WRYCLYYGWLLINSPTTLSFAFLFNDRICYIQNVCELSLTKNKIRYLQWEQYQQIRFLDV
KRFGPSGEEPRTFEIHCGTTIDYLFFPDGEDFEEWVNVLNSTLSQFIQLTKRF
Download sequence
Identical sequences A0A175JGZ3 C4LVY5 M3S8L3 M7VZ15 N9US38
gi|169802781|gb|EAL45027.2| gi|183230757|ref|XP_650413.2| jCVI|EHI_126000 XP_650413.2.49425 294381.C4LVY5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]