SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jCVI|EHI_135010 from Entamoeba histolytica 1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jCVI|EHI_135010
Domain Number 1 Region: 573-825
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.05e-42
Family Myotubularin-like phosphatases 0.0013
Further Details:      
 
Domain Number 2 Region: 1727-1974
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.3e-41
Family Protein kinases, catalytic subunit 0.00021
Further Details:      
 
Domain Number 3 Region: 828-1091
Classification Level Classification E-value
Superfamily L domain-like 1.41e-37
Family Internalin LRR domain 0.0015
Further Details:      
 
Domain Number 4 Region: 375-473
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000205
Family GRAM domain 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jCVI|EHI_135010
Sequence length 1987
Comment | organism=Entamoeba_histolytica_HM-1:IMSS | product=hypothetical protein | location=DS571203:17722-23745(+) | length=1987
Sequence
MSMGSTTFRPKDRHKTKKNGMFELFKGQKPESRSVPPQLSERTLTTTDIESTRSHEPLLF
LRKSESHKPQFRLKTHTFDGVPLVLENSFRFIEKVTRETKAVKPYSQMTEIELNEFINKF
GEEKLTKYVKEKQLGKDIKRISLEKLIKLGINEKKAITIQNDIINYENKSKIGKHILLMK
VNSDKALRKMFELMKGYEVNEIKQFNEMPKDEAHLIAFMAIRTFFAKKRPILINEKKAHE
LFEAYNQLKNDEIQLMNEVRKFIGSLEQNGVILLRTLKFIHRMISDDKSCYYYCKELFLH
TMFSFFYEGDSSKIPKFYFLVDLIDKLIPKKTQSKLERVFESDSLYGGEVILYIEQPSKI
PLYMILNQEQLNKECLNTWVGGKLYLTNYRLIWRTSNESLGSMAQCYYFNQVPLKMIFEA
SAVSGNGSNSSQCPHCIKIISRDNRILLFSMENEQRVISFKERLIYIANKVRNQTMKIDD
YEQFYFKNIFENIWEKTATRFGVDIKSPNSLFCVQNNLKDRNRCSFEGITFRHYQLIDET
HLEMDEFKRSPILIHRDKSGSYLFKLQYIFCKDHTTSQLKYPDELKQIFTTICTTEIVFV
NSTYNTNPSLLKTCDTLQDSFHNKVVKLMNDVNEKTIGELNGYINYLLEYQEIILSVTMN
IINKLTHGESIILLPNTKNASEIGIYTSLIELLTDKYYRSFEGFLELIFKEFVQYGYFKT
ICQYNLYPVHFLVFLKMVHSFIYYYPYQFGFNSTLIHFLYQHCNSGRFSAFEGSSTQGVF
VYLYSNKEFFVNNSFVNEECDFYHKYCNKELPLVHCPYFFFRWMNYTYKQTDLFNTSAAV
NFDLHERGTLTEIPSYIKDVSKAEVINLSNNPLMIIPECLQVYTTLQKLILSNCKLNCIP
KHFFDSLTQLTYLDISNNSGTKSIFFTPLLSSLTNLKYLDLSSQVFFEPNALDKFTFPIN
LKTLLLTNCINKLPHSLTKIKELETLDISRNSCINISILPQLTSLKNFILESCEQKTLPT
QISFLTYLTKLDVADNEIKELPYWLYEMTQLKDLNLSTNLLKYISIKQTQLTSLTHFDIN
NNSIKSLPVVHPLLNGVINCFMPPVISKIHVLSSSFGIETMKMVTDEWISMTNNSTNSII
FLHSTDEICGNSSLNKKDYFTFIYHDDSSPISFNFSRNDCYLIVFTSKEIETIYYWKYYL
NLVLPQQMSVFVLLLADIKSSEKDFIESTVKDTFKQCDFLHLAKGKENSRIMAEKFIEWI
KKFKHRWENEEYELLEIDQELLNCEINPPIVNRAQLEKIIETFGINKEKHTRFIDELDQS
GTIISSVSVLNIIKNNAPDLLKVLPCFDSMEEVFILKTNLFERIYDIMYKNSTKGIGMMS
DIYPKLQWCGNMNITLFSFILFKMELHNMLCVYFDEWFKKFHLTNNYEGFKQEGGIETLK
ELLNKPMESQHKLVLMTKESITNTQRINNKISEQNQQWIELRGDSIPEPKDCIPFVPFSL
HSTLSIANSKVIERIWPKQLEKGYNEYAWSFRNNYVPPIIYDHILVLILVSNSKIINMFQ
QYVFVEFEDHDQIYYLMIKLEYSRLIIKIRTIANSVTRSLYCISFIGELNKKIKEILSFY
SKELATNECVLCPVCIEEGIPDVGEMLVENLRIAIRNSNDTINCQPSISRGSYRQHIVSV
NNISIGIQLEVLKSDFSNLMIEGSKVKIKRHLLDDTDYILYEASYNNEQVCMKTFSYEGK
NEKGGSTRYLGNVFSTMMREANVAKTVNHPNFLALKGIVLTPLALLVDYCEQNLSLYLHS
NSTVDWKTNLDFIIQICTGMKKLHSIKMVHRNLRTSAIMIKINPITKERYAVIADFGKTT
PNYIGNKIEFTKDKREEDISKIAYIAPEVLQDQEFKSEADVYSFGIILWEIAHRLYPYEK
NKQSPPLFYQICNGIRPLPNVKTPYSQFNKLVFKCWHQQPTNRPSFASLCIDFQKIRSEA
FKLDKKK
Download sequence
Identical sequences A0A175JMW5 C4M0Y8 M2QGY3 M3TLU7 M7W9D9 N9TCX1
294381.C4M0Y8 gi|56468432|gb|EAL46278.1| gi|67471427|ref|XP_651665.1| XP_651665.1.49425 jCVI|EHI_135010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]