SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jCVI|EHI_135180 from Entamoeba histolytica 1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jCVI|EHI_135180
Domain Number 1 Region: 8-159
Classification Level Classification E-value
Superfamily Flavoproteins 5.59e-31
Family Quinone reductase 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jCVI|EHI_135180
Sequence length 192
Comment | organism=Entamoeba_histolytica_HM-1:IMSS | product=NADPH-dependent FMN reductase domain containing protein | location=DS571203:51648-52226(-) | length=192
Sequence
MNERLNLPKVLIINGSPRLNGTTFLMLNLIKQELEKEDIITTFFQLGGKEIKPCKAYQTC
KKSKTCLQGNPLVNELIKKMKESDEIVIGSPTYFYDVPIEVKGVMNLCGLILSTQLERKV
GVAVVVPCKGGSVYVYDTINHWFCSNNMFIVGSSHFIDRCINETTKERETENKKMIIRLS
KNLSNLLHQLKK
Download sequence
Identical sequences A0A175JN95 C4M104 M2RKD5 M3S0W8 M7WU83 N9V1Q0
XP_649750.1.49425 gi|56466247|gb|EAL44363.1| gi|67467261|ref|XP_649750.1| 294381.C4M104 jCVI|EHI_135180

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]