SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jCVI|EHI_137960 from Entamoeba histolytica 1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jCVI|EHI_137960
Domain Number 1 Region: 415-731
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3e-55
Family Myotubularin-like phosphatases 0.0019
Further Details:      
 
Domain Number 2 Region: 1538-1812
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.31e-50
Family Protein kinases, catalytic subunit 0.00024
Further Details:      
 
Domain Number 3 Region: 747-989
Classification Level Classification E-value
Superfamily L domain-like 4.68e-26
Family Internalin LRR domain 0.011
Further Details:      
 
Domain Number 4 Region: 287-418
Classification Level Classification E-value
Superfamily PH domain-like 5.33e-21
Family GRAM domain 0.016
Further Details:      
 
Weak hits

Sequence:  jCVI|EHI_137960
Domain Number - Region: 143-262
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.00392
Family BCR-homology GTPase activation domain (BH-domain) 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jCVI|EHI_137960
Sequence length 1815
Comment | organism=Entamoeba_histolytica_HM-1:IMSS | product=hypothetical protein | location=DS571187:65748-71291(-) | length=1815
Sequence
MQSGVYPMSSISLTKKKIGKINKIGSENEKTFKDIPVVVHQLMVFIYHQSTNKLNYLTER
KLGEFPLHWDRFNIKDVEIIKSYSLLKCRNKTIKELIQLGFTEQDSLTIKEECKSVGDNY
FTLLNTNGNISNEDFVRLISTSHKYSLGELPVLVRDKDTHFAFVLLKYFFLCLPKPMIND
SVLKVFEMGLSMKNKLGIERLRNYLMGEIENIMLRMNEDSPCAFLLFKEMILFMRAFVEQ
NGLNGQEKEELYLCYFNAMLQNNSFKKEFLPLVDLMFFEQRYNRDINELFPYEKEVVIKK
YEFAFCPLFCVGLTEEIDTNDAVPGSVYFTSHRIIFMPDSQLNQRELNVLKYLGCSSICN
VLGVQVSQNEHSHCLRIICKDLRVLSFRIVGPIQPYEEMIQNIIQHYRYPTETEYLYCTS
TINNVIINEVKRMGIEGHIESINMMSVNVPICQEVYHINEKDLKAVICYQHSNGSQLIRF
PLLKNVYADTVLSSFTIKMKEGYQCTISKYDIIGEHEISEMVNKIQELLPTVNTKNNQNI
SYLFEASNRISDEIRTTLDYTFRLVKQITTKQIHLILISNKNCEKGLCVLSGLIQLVVDP
HYRTINGFMELIQKDFISFCFFENDGYEYSNYFILFLLCINFLYRQNNYAFEFDERLIQL
TFHSIFSHRFYEFNHSQVNSKSSFISLVQYYSSEFVNPLYQRSNELLKNELIEGDYCALI
YKWLNYSKKCTKVFTSDILSTKNIGLRIYSFPPIDICISSFSTLRILDLSSNRLKDFPVE
LLQLPQLIELNLNDNDIFYITPRISQLSNLTSLSLGNNCLVNLPELSNIPLRKLDLSSND
FPRNFQFELGNDLEYFNGSEFLSYPTILGSLPNITSLNFSHVRFDILDIINNPPRSLQEL
KLSGCRLPIIPEEITRLALTGLDVSDNYISKMNYSFFSMSSLRVLNISSNHVNGTNALFK
TMKQLKVIANNVIPRKTKLSLISIPSLKTMKQMCNDGIRLMELECIIITGSLLRKEIFTI
LQKKFIEEGSIQMNEEHSLTFEFIDKKKKEKKSLVIIEMSIEQLLNDIWRLRRSLFIVCK
QNKESSEEEVVLELLKMMEIHGYIHIICNEEINVKEYINVDNNMMDIEYYCYMDNKKKKT
ITCLWNKLFKQINKMVIEGDENCFNLLNELSGLRIPGFCLTIGKIKEIIQCLGMKEWQKV
LNWLTRNGYLLTDNDFRDKNQLVEFKDDQQVLVDWDLFPLTSKTIQKNCDKNGFLCVNIF
ELLGIKNDTIKFILRLLEKNGFLIQITKDIVKPFRCQKQFENVFKYCSEQSSQLKKYSQT
TSSSSALSSNGSWSSIPIIVTEKIELSNVILYTFHDYKDSFNKDIWPEQHLRNEIEIGRI
IKMKVINYKAINLIISILMLKYTVHSYWKNGAIVIVQKGRNLGKLYVLIEGKRLSKTIEI
RIRGLVNDVEIPFLMVNTINTIFNEIKIICQQTNCKIERIDALCNECLSKGIKTIIPNEI
IKQNINSFIYNFKWKEHEINSVACLLDYIIDSFPKHCIDSLDQFNFINDIGTGSNSTISL
FERKVNKELMVLKLGNIDFSVTGINKETTAIQLFTSILEEFLREINFINFPSHQSIAKIY
GYSLYPLFVTIEYFNGGSLYSLINQNHYEFSLHEKIQIAKQIADGINFLHTYKIPLIHCD
IKSPNVLIKLDNNKSFVSCAISDFGETVPAYASTSSKVECPYWLAPEVISGNAFTQKSDV
YSYAIVLWELSTNKTPFSEFKFFSEIREKVLMGYRPALNEKMTVFNSLITHCWNADQTLR
PTMKEVLVQLESITE
Download sequence
Identical sequences C4LZF7 M2Q900 M3TQ03
gi|169802356|gb|EAL48462.2| gi|183231741|ref|XP_653848.2| jCVI|EHI_137960 294381.C4LZF7 XP_653848.2.49425

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]