SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jCVI|EHI_141820 from Entamoeba histolytica 1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jCVI|EHI_141820
Domain Number 1 Region: 1632-1915
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.75e-62
Family Protein kinases, catalytic subunit 0.00016
Further Details:      
 
Domain Number 2 Region: 492-768
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.9e-37
Family Myotubularin-like phosphatases 0.0045
Further Details:      
 
Domain Number 3 Region: 766-1018
Classification Level Classification E-value
Superfamily L domain-like 6.12e-27
Family Internalin LRR domain 0.021
Further Details:      
 
Weak hits

Sequence:  jCVI|EHI_141820
Domain Number - Region: 360-449
Classification Level Classification E-value
Superfamily PH domain-like 0.0656
Family BPHL domain 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jCVI|EHI_141820
Sequence length 1925
Comment | organism=Entamoeba_histolytica_HM-1:IMSS | product=protein kinase, putative | location=DS571161:37669-43545(+) | length=1925
Sequence
MSLVVSESKSKLSRRHKPFFARGSNSRATESSELNTGTTQTETTTTTTTLTTSHFEQMTI
PTTSNEYLKTNQIELTFSKVPLILETSFKYNETILHLLPPPPKPLRQYTTLELINWIKPN
APKEFCEYILTKKINGNTIRKLTKRKFSRHGCSIKQSVELTEKIKGFDRETSFGLIVLEN
LNFSDCLVREMYRFTEGFKKKEIVKLNSFDYYKGITLTFMALTYYFAQNEAILTLENLKE
ITERINEENPFDRIVSTTQNKMIINRTFSFLKTMIESETSVFYYFKEELIDYIINCIAPG
LDPIPFRCLLKFSKKENNSHCIFESDETYAGEQIILYYKEVLMPIYMLPINETITNLDKR
EWENGELAVTNYRMMWIPYNTTIFQDKMNCSSFYQIPIKSIQQSSLSESSKEKEKVYLIR
MLSYTSQMITFGFKNIENANEVQSTVQQLEKKQYWIDEYDVYCNEICIKNNSKRIYKELK
NNKDLILKPIGWNDEEYIYYSKRECSKLILIDESEKGGRIFRIEINNDKNEINNKRISEN
IQGEIIDLSYLDDKILEEEMNNYYRFITKIKKEQIDKMYNKLTFISDEMKKIMSCFFDII
PRFKQGYSFCFIGKEDQTESCGVSALFLIITNKYYRTFNGFLELIHTQFVCSKYFQVVYS
KGYHPFNFCIFLHMINCIMYSYPTIFEFTPYLLSFLTYHTFSHRFSTISSQKNPTQSLYS
YLLNHKIQFIKSDFDNFAFDIMEYWPQSIVLLQPNLFIDFINYTKDKNPILSIQSNSSID
LSNYYLTSLPHYLWQKIQKEQIQVMNLNGNQIPFIPNEIVTLPNLKELQMKNNTIQYIPQ
WHLYHLTNLTFLDISERPNNEASQYEMITFDILCHLKYLNISNRPLSPDISFPLSIRTIV
ATNSFETLPNKMTKLTNLISLNLSYNPKINTNQVLQLNKLKTLKMSYCNKTRIPNLISTM
TNLTLLDFSYNIMKGLPLDLFNLTNLSILDVSHNNLQYLSQLHTKLIQLQTLKIDGNSDI
KIPQTQKDHIKSIPQIQTTIFETPLHILSDNKGIDLFKKFYSEFKNSKSDNIKLYEQLPI
DDEPKAHHFLLQYHDFNNRIGFIPPISDCYIIILSFDRWRSVLSHWKYYLQRVLPNDESI
KMRIMFFVENKKTAEDQSAVDSIKKQLLPWQSDVIVLTLKSKKKLNIESKLKKLISDFKV
IPNVYNESILKVAKEIKMATFDPPVIKEGQLYKIINQFNLEGNFHTIINALHQLGVIISV
SRSIDKKQRVENKINMYNLLSLNSTNSNLVIVDLSIFENINFYLEKQAQNGFGFIENIKE
IIHSYRGMSPDTINVIMYFIQMFYDVFIVSDDFLNKFGLQEKYEEFVSVHSITRIDILSS
LYSHQINKLPTKRSKFNHMINRSLSTAIEIPSFSQEDEIHSTCRTPAASTSQPIHISKTL
YFQPRLLPHIEPITLNEYWPKFHDTKEMDFGRVINFQYIPPIYFAYFIFIALIEGLSITK
VFMNQCILTKIAYEQHFYFYIECNEHQFTIRTRYRAATVNSVLVAAELMEVLLDSFYKIH
DELFPTLEYDELILCPTCLILGVDKCSAIPLKEINEAILKNKEVISFGECHTCMVSTCSL
DLSLKDLRKKQQNKLFSVEINRSELTNENLLGIGSTAKVYSTIYNNKKAAIKLFSFEPSQ
FSSEKGKGGAAHLVSKSITELKREICIMNLIESPYILKLYGISFDPLALVMDICDKGDLH
EYIRNKNNDLSWPIMLRFAYQIASGMASLHKELIIHRDLKSPNILIKTNQQGELTCVISD
FGLSGTYNEEEKYFVDNPRWVAPEVLINKPFTLAADVYSFAIILWELLAREEPFNDFKFP
SQLRTSIITGLRPTIPNSPYIRYKELIQKCWSQDPILRPPFSEIVDKLSLFRKMVEKEFE
ILPVS
Download sequence
Identical sequences A0A175JGT5 C4LW29 M3SCI8 N9T970
jCVI|EHI_141820 gi|56471713|gb|EAL49260.1| gi|67478511|ref|XP_654647.1| XP_654647.1.49425 294381.C4LW29

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]