SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jCVI|EHI_148280 from Entamoeba histolytica 1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jCVI|EHI_148280
Domain Number 1 Region: 190-448
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.17e-80
Family Protein kinases, catalytic subunit 0.000000442
Further Details:      
 
Domain Number 2 Region: 1-89
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000268
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jCVI|EHI_148280
Sequence length 467
Comment | organism=Entamoeba_histolytica_HM-1:IMSS | product=p21-activated kinase | location=DS571146:49655-51058(-) | length=467
Sequence
MKSWKRKWVRLTKTDVYVFDSPTKNTPILTIPLQRTVVSLVASMGDSYLKLDSKKLGKQF
IFNAPCKDQAERWVTAINNTIDAGLTRPSGMTQVVHVDFDPNLGYIGLPPEWERFLNEGG
ITTDEYKKNKDVVDDVLNFQIQRQGDKTNLPSVPAPISQPKQSKAVVEPLPEDVEKVQLK
DVTIEQDPREFYSDFEKIGEGASGEVFSAKRKADGIVVALKQMEVNNDNEKLIATEISLM
KGCKHDNVVTFYEAFYLPAKKLMWMSMEYMDGGCLTDILENHDIIEMTEPQIAYVCRETL
RALNFIHGLHCIHRDIKSDNMLLTNDGHVKLADFGYAAQLNQKQKNRNTVVGTPYWMAPE
LIRGHDYGVKIDIWSLGIMVMEMAEGDPPYMEFPPLRALFLITTKGIPPLKNAEKWSRDM
NGFVARCLETIPDNRADSEELLQHPFMKIACENTDFAQLIADVRKLA
Download sequence
Identical sequences A0A175JDR8 M2REJ2 M3TVH0 M7WU31 N9TIH8 Q5FZP2
294381.C4LSZ8 gi|56474765|gb|EAL52122.1| gi|67484584|ref|XP_657512.1| XP_657512.1.49425 EnhiA.00766.a jCVI|EHI_148280

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]