SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jCVI|EHI_148440 from Entamoeba histolytica 1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jCVI|EHI_148440
Domain Number 1 Region: 325-589
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.89e-74
Family Protein kinases, catalytic subunit 0.0000231
Further Details:      
 
Weak hits

Sequence:  jCVI|EHI_148440
Domain Number - Region: 150-227
Classification Level Classification E-value
Superfamily PH domain-like 0.0146
Family Pleckstrin-homology domain (PH domain) 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jCVI|EHI_148440
Sequence length 600
Comment | organism=Entamoeba_histolytica_HM-1:IMSS | product=serine/threonine-protein kinase, putative | location=DS571146:74364-76166(+) | length=600
Sequence
MKAPYAHNLDYDSRQLIEQLMLTPNDKRTPLNQIFFDVAVGFNKRTEYRMLWFRFDIRKL
YFLRHGDPREELLFSSFSFVTLEDNNSKIKLIVTDFVENPKTYFIITQSQSDTLQIFQLL
RGISTRPTMLFFEQDFYQDYVNKKRTVACKKRGQTAWARRDMIIFNGLFVLYGETGRIPL
TMCPMCDKVNIMRHPRNVLEITTSIRRILLHFDSDIDMNDTYECLLTCDQYIRQPIMFPV
KDFFTGKLGDLHQSCREVCIKNMLYPEECFDNFPVLCEILRAVTKKRCVTVGDRKTTKKE
EEELTRRPPPPPQVPLQEDDLGQYCIKEDPKKYYSNFVSVGKGGFGEVFKATRKEDGAAV
ALKVLRHSVDERYAKIGCEVARMKLWDHPNLIKTIGCFLYDHKVYIGMEFCSGGTLKSML
KPRNQGLSFSEIAYILKQSLQGIAYIHQTGFIHRDIKTANILMDDHYCVKVIDFGLVVRK
SSQPQNRAGSKSYMAPEVIKQIPYDEKVDIWSIGCVAQELLESQPPYKEHGVIKGMFKTA
AFGAQYLRDETKAIEPFVDFVNKCFAYDPRDRPSCDELLTHKFLQYAQQSNYMRRCYEIP
Download sequence
Identical sequences C4LT14
294381.C4LT14 XP_657496.2.49425 jCVI|EHI_148440 gi|169803108|gb|EAL52106.2| gi|183229812|ref|XP_657496.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]