SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jCVI|EHI_148900 from Entamoeba histolytica 1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jCVI|EHI_148900
Domain Number 1 Region: 185-460
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.72e-80
Family Protein kinases, catalytic subunit 0.00000264
Further Details:      
 
Domain Number 2 Region: 14-112
Classification Level Classification E-value
Superfamily PH domain-like 8.56e-27
Family Pleckstrin-homology domain (PH domain) 0.0027
Further Details:      
 
Weak hits

Sequence:  jCVI|EHI_148900
Domain Number - Region: 122-163
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.00837
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jCVI|EHI_148900
Sequence length 479
Comment | organism=Entamoeba_histolytica_HM-1:IMSS | product=protein kinase, putative | location=DS571146:179290-180781(-) | length=479
Sequence
MSIDLATFSYVSIPTNKIIKEGFMVKRGHIVRNWLQRWFVLTNDILYYFDEQKLHLKGYI
PLAFGTITRSPEMKKQPCFQLVSPLQNKTYFIQCGTEDECGLWMAAISVVLNKYIGEPET
MDHVTHVTYNEGGFCGIPPEWENMFIALGITKEEIKSNEKEAMQVIQFTKKLEDQPLGPP
PMPENETTITLKDIVQPGNPTELFDNWQQIGEGVSGVVFQCVDKKTKEERAVKKIKIEDD
SINLQEIKIMQTLKHPNIVGFFGCFELDNYLYISMEFMDRNNLTAILEFFPSVAMNEPQI
AYVARETNEALRYVHSFHRIHRDIKSDNILINHNGEVKLADFGVSVQLTKNKSKRNTIVG
TPYWMAPEVIKGKDYNCLIDVWSLGIMCREMMEGYPPYMDDPPLRALFQISTKGVPPITT
GSWSKELLDYVNGCLSVNPDQRPSTESSVKNPFFQKACTKIEFADFVSRVEQIALEQQN
Download sequence
Identical sequences A0A175JDG6 C4LT57 N9URP9
XP_657576.1.49425 jCVI|EHI_148900 294381.C4LT57 gi|56474805|gb|EAL52161.1| gi|67484712|ref|XP_657576.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]