SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jCVI|EHI_151670 from Entamoeba histolytica 1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jCVI|EHI_151670
Domain Number 1 Region: 1596-1886
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.7e-51
Family Protein kinases, catalytic subunit 0.00024
Further Details:      
 
Domain Number 2 Region: 467-777
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.72e-45
Family Myotubularin-like phosphatases 0.0025
Further Details:      
 
Domain Number 3 Region: 788-1015
Classification Level Classification E-value
Superfamily L domain-like 1.59e-24
Family Internalin LRR domain 0.043
Further Details:      
 
Domain Number 4 Region: 196-294
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.0000373
Family BCR-homology GTPase activation domain (BH-domain) 0.024
Further Details:      
 
Weak hits

Sequence:  jCVI|EHI_151670
Domain Number - Region: 359-453
Classification Level Classification E-value
Superfamily PH domain-like 0.000123
Family GRAM domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jCVI|EHI_151670
Sequence length 1893
Comment | organism=Entamoeba_histolytica_HM-1:IMSS | product=protein kinase, putative | location=DS571145:113382-119174(+) | length=1893
Sequence
MSDLDSFSQNSYKSKISSYSKKPNQISFKQLAEKSLLDIKHKFYESNSIIQPKEESNLKL
FKRVSSMNSTNYDWKRLRCFHFSLKEMRINDFNMKGIPIGMYNIMKYLYNSLSNNLDWFE
QKEIMEFSEIRQMKKVDSLLSLTTFELLKNYSLKKLLQLGITQKDAERILLLCKQNDHSN
YFKHLNKNSLFENEDFKLYFNLINKFNSSQIPLLNNICTIQNAFVLLKLFFLFLPSPIIP
FCFLDFIKQQENCKLNNQIVINKLKELVGKVEFNVIKELFKFINEISEMTQLSSDEYKEF
VKCYFNAMLQQSGFKKRFVKYFNGITENEQFIGTEYIHQIEGEIVVLRIDESYCPLYILN
GKEVLDMKNTSTYIKGKLFITNYRVLFIPSQFIQEDFMRFLGECWIGEIDSIATFDKDEG
FYVKFQCKNIRVLSYYCISTKFNFNEIIGHLQSLQNYPNEIISLPHNVMINKNIDIICSQ
EATRMKIISNEKGKYYSPNLPLYSHCVIDTIEINKPVVIVYQHLNKSKLLRLAKIINEDL
YEEVYEIGSKAEKALKIYCKSIDNTDNIDNIFQDLKNFVCEESINSENIKSYNSLLKSIN
EIVNNLLFKVIMIFDNLHNSCEDILLINDKTGEEDVSIFSFLTQIIADPYYRTLKGFLIL
FQKEFIGFDAFISSQTLLLLVLFFLAIEELINQNLSQFQFDSRLTYFWITHIGSRRFNNN
NENGKCDQLSAIINYIYSDSSGFINPFYKPIQTELIFKPYKCYYSFDKWLGYSKDNISLF
NKLNKDKEVVQFSKRNISHFPPYQSLTLLLKDVLSIDLSSNRMSEFPPSLCLMTKLNKIS
LQRNEIYYITDEISKLTNLNELSLSHNNITILPSLISLPLKLLDISFNNLDKHQALELSP
TIETFIAQGVKYYPTPICELTNLNILDLSQTKFELEPLFNNPPNHLKELILQHCELRKIP
ENITKLSVTKLDVSHNYIMKINHSFFSWNSLIELNLRDNLIYTKSVLFNNMDNLIDCHID
AQTTQSSLSCDTDNIDIQAIQQVIISGDELRNDVFQYLLKKMKKYGSIREIKELGFDFII
KSSKKKEKKGSSEVLATIQFKVKTPEEIEDTLWEYSKCIFVVCKSTNENSISERVMEMLK
LLPYSLKIHFVSGLERCEKYIEMYKELSITVHKNIGDKNKWSGLSKKIFEQINGKVNKDV
KPYVQVMVELNVLEFDQFCLNKQKFSEIVHCLNLSDKEKEIYDVLIKWGYFIQMPSVSPF
IEQSINLNKGDMVLIDFSFFKRFLNIADSTLSINGFFTVKIFERLNIQQENLYLLLTLLQ
QFGICYILTKQFAAIVNEEKRFNELYSELINNKSETPSIEGTISSCSCSCSVSSEYTFRR
EPKTKGEMLNLENVLIYPSCSFKTCEMSPKKSEKEKKVKTVDTNYLKENSINKQWPSHHY
KNEVEVGRVLTLMSLNFKILSCVLAMVALKYHVIIQWKSGILVYLEVSNEQNYIMIYGNL
NQKTIIIRQRYLITSGDSCFIAINELKEITEFIQNILSIHSIKIKSIDIYCPSCLEKGVF
HIVNQESLKKGINQLQAFINDKQCSINLVLSSFDLMIKKFNNQYLMDINNFKFKQRISNG
SNSIINLFETLKNINGIKKGTLVIIKQSNFDLTNINLHKDKSAAEIFGSYVQEYLREMSF
IGFSSNNYIAKIYGFSIQPLSIIMEYFNGGNLFNLLHDENIESKYSLTPKILIQFATQIA
EGLNTLHHASDPILHRDVKSPNVVIRLNNDELGTCAITDFGCSIPYSLNNTNKVECPYWL
APECIINKKACLKSDVYSFGMVLWEMSTKKIPFEEFRFFTEIEDKVISGYRPPLDKKEIY
FNRLIEMCWKSNPDERPSFDEILKLLKSINVGK
Download sequence
Identical sequences A0A175JD58 C4LSK8 M3S9I2 M7WH06 N9USW7
gi|169803134|gb|EAL52028.2| gi|183229645|ref|XP_657414.2| XP_657414.2.49425 jCVI|EHI_151670 294381.C4LSK8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]