SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jCVI|EHI_164520 from Entamoeba histolytica 1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jCVI|EHI_164520
Domain Number 1 Region: 6-145
Classification Level Classification E-value
Superfamily Flavoproteins 2.75e-42
Family NADPH-dependent FMN reductase 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jCVI|EHI_164520
Sequence length 146
Comment | is_pseudo=true | organism=Entamoeba_histolytica_HM-1:IMSS | product=iron-sulfur flavoprotein, putative, pseudogene | location=DS571214:60451-60891(-) | length=146
Sequence
MSKPIKVFMINGSPREKGNTFTMLSWVKEGLEKEGIEVEIYQLGKKEIKPCVACYACQKT
GKCWKDDSVMDELLQKIIEADGIIIGSPTYYADVPGVVKTFIDRSQPIYYSKKTLRRKVG
AAVVMARRGGAIHVYDTINHWFGIIQ
Download sequence
Identical sequences B1N3D7
294381.B1N3D7 gi|169802089|gb|EDS89525.1| gi|183232366|ref|XP_001913703.1| XP_001913703.1.49425 jCVI|EHI_164520

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]