SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jCVI|EHI_193290 from Entamoeba histolytica 1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jCVI|EHI_193290
Domain Number 1 Region: 599-905
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.28e-83
Family Protein kinases, catalytic subunit 0.00000218
Further Details:      
 
Domain Number 2 Region: 77-167
Classification Level Classification E-value
Superfamily PX domain 2.22e-20
Family PX domain 0.002
Further Details:      
 
Domain Number 3 Region: 179-273
Classification Level Classification E-value
Superfamily PH domain-like 2.55e-16
Family Pleckstrin-homology domain (PH domain) 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jCVI|EHI_193290
Sequence length 982
Comment | organism=Entamoeba_histolytica_HM-1:IMSS | product=hypothetical protein | location=DS571265:5985-8933(-) | length=982
Sequence
MRHSETPRNAIIIAPFDRSNKTKTATPSVSPDNTLRERVSCDVRRVNQTALNVISITFLK
CELQIDISSIFSPGVVGMYFFNVQYDTHTSAIQKRYSQFYFLDNYLHMKYPKIKLPSLPP
KEILHSGSHPDVIHKRSKELSNYLENVVKLPNILNDMVVIEWFTQPPDHHLISFSKQKKA
GYVFKESSVFKRWKKRYCVLASNVIALFENAKDLLVYEDPIDVYCLKGCNVKPVLDKGPN
VMTISRNNLTLCCLYVENDDDFLGWLSSIQDTTLIRSKISDQPIRTKLKITNHSTKPRTR
PMSPLTLASTTMKRATETKRFSRIYDNDASNTYKNIITMIYERFRNEMNEIFPYFLVDCK
EIKPEHFSFFEELRSLQLNDFLEGKKVEDMFQKLLVISKEYTTSASVQRITWVYINIHKL
YKLYCFEGHTAIQQLQEKQTIPRLIPTSAIDSSKLLVCRLCEHQYKLSQFCDHTRLCEVI
TRGYLKETTCLQRIEMVMNYLRESYQCQMVKDTFKYTQLTELVPNFKTPLSIDKLQKIIE
AIRTLCVDVTDIPLLTFARAIGDLLTSYQNLLKEYAESKGSKNLWSFISVLSSKGNKQEL
LQLSTGTAVSVTDFDIIKKFSAGAYSRIYLVKKKSTGDVYAMKVMKKDDMIRKNVVDSVL
VEKNFLSKAHNISVVKLYYAFQDDINLYLVMEYCPGGDLATLLEHIGSFNEYVAHVYSAE
ILLSLHYIHALGCVHKDIKPDNILINRNGHLVLTDFGLSSYGLVSQETAGKTGIFCTPDY
AAPEILISNSYSFASDYFALGCMLYEFVVGYPPFNASTPEAIFMKIQQGVYEWPEDVDVS
DDCKDLVSKLLCPEPEKRPVFKQIENHPFFSDIHWDTLFDESREDIFVPQLDGDNDTGYF
EDERGMKQSHMKKDDLIGKPFNKDEEKTKRNKKNEVLIKRKESPIPDGGEFGNFDVRNID
NLIEENRKSYAKEFARFEMEDL
Download sequence
Identical sequences A0A175JRL1 C4M4T3 M3TSD1 M7X4H8 N9TGX2
XP_651956.1.49425 jCVI|EHI_193290 294381.C4M4T3 gi|56468750|gb|EAL46569.1| gi|67472192|ref|XP_651956.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]