SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jCVI|EHI_197200 from Entamoeba histolytica 1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jCVI|EHI_197200
Domain Number 1 Region: 1417-1687
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.71e-46
Family Protein kinases, catalytic subunit 0.00022
Further Details:      
 
Domain Number 2 Region: 471-736
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.09e-26
Family Myotubularin-like phosphatases 0.0092
Further Details:      
 
Domain Number 3 Region: 727-929
Classification Level Classification E-value
Superfamily L domain-like 2.52e-25
Family Internalin LRR domain 0.02
Further Details:      
 
Weak hits

Sequence:  jCVI|EHI_197200
Domain Number - Region: 336-458
Classification Level Classification E-value
Superfamily PH domain-like 0.00148
Family GRAM domain 0.053
Further Details:      
 
Domain Number - Region: 174-280
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.0216
Family BCR-homology GTPase activation domain (BH-domain) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jCVI|EHI_197200
Sequence length 1690
Comment | organism=Entamoeba_histolytica_HM-1:IMSS | product=hypothetical protein | location=DS571157:73615-78687(-) | length=1690
Sequence
MTLADTKKEKRTTMSFRLTDAFNKKPQPLKHSETMIKNQTPQKHERRGVFFEVEKTVVFG
TPLEKLKESQCGFKGVPLVIEDCCHHIRDCVISNRKFINKWDNKQLNKFLVQHGGKEIKN
LTGKEIMTVNYEDLKKMGFSEEEIKKTLNIIQEEKKNVISFDDILNNKFSCCEIKQMYEL
IKKYDEGKHVNLYECSTVKISMLLLRTYFIMLEPSLFNEDLCKKIDSIFTQSNNSDGKKH
IYELQQQLIDYIKESISPTAFNVFNLMNNFFLTIGNHPKSLVLNEFNEIVIYFFESFNPR
HEFDQGYLELIPILLGLSNDDQINLLPPYRIETLDRYDGEFVQFTVNNVICPYFFFPLTT
FNEYNTAGWFKGILYITNYRMLLDCDDTSMLYDVCFTQVPLNNIGFYKITKEYIEGKVYS
ALRIIATDFGHLTFFCENRYSEELLHCLEEHIMFFNFSYEQSKFNTLGIKGKTTKQLITE
ENKRQNCGIIPKEYIHIWKNPNSKVELNICQTGMTTNNNYIQVNGPDIPFASLIELINNN
IGTPISDDIFNKMTQFAYQTLEPAKEIAKKLLTQSVLVSSNGIGEIKALLAISIISLDSY
YLSLDGFMVMYRTFFKFTDTYQRMVFLWMIWLIMNQHPQVFGFNYNLVKTLFYHITALRF
NDDLLHQFVLNNRQYFATIGKVKFAILNDIIPRPSELFFQHPSIQQLPKMNQQIVIMKNT
SASTLLPFTPTTIQTLEVENNKFFDIPMKVLSFSKLNTLKMANNKIYVLSDGISSFHNLT
YLDVSNNNIKWFPLLGVIKLKYLDISNNPITTISFLPTTLTTLNMRGLCRMPDLTQHSLI
TLDCSGTSSISSKTLFHNLPKTLKELDISSRGMLSLPIKISKLTSLTKLNLSNNYLTVFH
PSFFELGIKELNIEHNHIKMLPPTFKKMPIEKIIKDDFSYEKKVIEKRVVLIDNSTEIFN
SLIRQSKHINWNIKEEPRSAKLIIKNNIVIDLKVLDLESIESQPYFGIDALYIIHIRESI
PFRIIDLCQVTSSRNYIVISDKIIEDMTTIVYDGTPQTLKSICRTLRKFIEDFGKDEISS
NCYEILKTLQCYDLSPAVMTTALYQEIISSLEMKENDINKAVHQLVERRLLHRSCLPSTT
PRNKRGLRPSVIEVRTNYSTYYSEDFGYILVDTLNISHIAASLLIQTKGIFTARALQSCK
MNGMKNNMQLNYIISVLEEYSIVLKVRLDLAKNIGCENEYPLLLEQAKQATLVSQDVCSI
GNDIILLSLVGVPYIGNWEEQNDTIISSRQYTFNKFPLQLQQCFIASCALYFGMPYSLWR
SGVIFKKEIRNEVIDVLIKFSTSSFEVHTRYHLSSLQMAVDNGNIHHSLEKFLDQLISIY
FLNVKFSVSLLCPHCLNHSIKKEDITNSFLIHEEDHSYNIPLIAMDYFFSILPPSLSSPT
LIKEITRGSSSIIYLCVGGIVLKQINSDFKSLKRNDAIHDFNCRIHEFYNEVIFSQYCFD
NVGRILGYVTEPFGIEMEYYDGGSLFDLIGDFTQPIPVHSILVDIANGMKNIHQINKLHR
DLKSLNILLKKQAPNMFQAFVCDFGESTIEGEQQSQIECPFWLAPEIFKGEQWTKASDVY
SYGVIIWEVITRQRPYEGKFYNEVKESIIEGERLEIPKNCRYEDLMKKCWLENTEQRPSF
EDILNILKQL
Download sequence
Identical sequences C4LVD7 M2SFJ1 M3TBZ6 N9V1S2
gi|56470988|gb|EAL48591.1| gi|67476876|ref|XP_653977.1| 294381.C4LVD7 XP_653977.1.49425 jCVI|EHI_197200

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]