SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jCVI|EHI_042150 from Entamoeba histolytica 1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jCVI|EHI_042150
Domain Number 1 Region: 116-408
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.83e-91
Family Protein kinases, catalytic subunit 0.00000032
Further Details:      
 
Domain Number 2 Region: 6-98
Classification Level Classification E-value
Superfamily PH domain-like 2.2e-26
Family Pleckstrin-homology domain (PH domain) 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jCVI|EHI_042150
Sequence length 433
Comment | organism=Entamoeba_histolytica_HM-1:IMSS | product=PH domain containing protein kinase, putative | location=DS571259:27558-28859(-) | length=433
Sequence
MEEKTQGWLMKEGGSWKSWKKRYFELNNDSLYYYKEQDKKTLMGIINLSLATHITAVDNY
HKKYENIIRICTPSRTFHLSAANEEDRLLWLTSIICHSQQSNIYKSKITTETVTQKDFDV
KCLLGKGAYGKVFLVEMISTHEIFAMKTIEKKQIIEYEEIEHTMSERRILSKLHHPFLVN
LYYSFQTPTHLFYIIDYCPGGEFYYYLQKNGKVSEEDAKFYSAQILLAIEHLHSSNIVYR
DIKPENILIGADGYLRLTDFGLSKENVTKENTTSTFCGTPEYLAPEVVVGKDYSEPVDWW
GFGILIYEMIHGHAPFTSEDIQQLFQKIIHDPVIFPNVSYPTADCKRCIQELLVKDPEKR
LTDPNRIKSHCWFKGFDWEGLFKKKLTPPFVPVLKDKTDTSNFNEDIINETAKIDEGEVV
DSKDYFNDFTYCK
Download sequence
Identical sequences A0A175JS58 C4M4G9
XP_656547.1.49425 294381.C4M4G9 jCVI|EHI_042150 gi|56473752|gb|EAL51161.1| gi|67482395|ref|XP_656547.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]