SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jCVI|EHI_094010 from Entamoeba histolytica 1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jCVI|EHI_094010
Domain Number 1 Region: 81-217
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 7.22e-23
Family PWWP domain 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jCVI|EHI_094010
Sequence length 335
Comment | organism=Entamoeba_histolytica_HM-1:IMSS | product=hypothetical protein | location=DS571179:71925-72932(-) | length=335
Sequence
MEEEKQVDTTTVQSSTPPMSPQHSHSITPSASPKENKVSTPLSPNKEDGSVATPTSRKKE
EETKPKKSPNDSVTVIDKEIEQNKWDNWTVVWVKQKGYPWWPAKIIIMDKLNEKTKGQLE
KLIEFKKDKKYLVKYITNGYQFGWVNDNQIKPFKEEFMNIITERMLGKKDVIESINKAIE
ITNDKISENDIDKFHKAVIKKEKQMEEEEKKKEKMRNCDIGFMVVNDPLIEITKIEGIVE
KSIENNNSSLQKLKNWKEMDHSQVIEELNTLMKEPIMIHEIINPINKIGELLNSICQSTN
IEISVLAERVLERIKKELKYAIISGEYQRCKEIFN
Download sequence
Identical sequences A0A175JJJ0 C4LYJ2 M3UZS9 M7W3R8 N9TPU7
294381.C4LYJ2 XP_657269.1.49425 gi|56474527|gb|EAL51892.1| gi|67484098|ref|XP_657269.1| jCVI|EHI_094010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]